CAZyme Information: MGYG000000756_00533

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_00533
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000000756_8|CGC1	45898.75	4.274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 31775; End: 32992 Strand: -

Full Sequence      

MGLNYIKGVNLGNWLVLEKWMNPALFDGTTADDEYYLPTQLDPAVYEARIKTHRAEYINE
RDFATIKSWGLNSVRIPVPYFIFGDRAPFIGCIDELDKAFNWAEKYGLTILIDLHTAPMS
QNGFDNGGISGVCKWAQLPEEVEFVLSVLERLAKRYGNREALMGIEIINEPNTTTSWPMM
NVTERYKAVDAELAEGTGPIEFDWLKNFYITAYRRLRDVDKGALPTDKAVVFHDGFDIEQ
WKDFMRGADDKLASEFENVILDTHQYLMAAEMIGCPQTVEGYDDFVRNTYAPMVAEMSEY
FPVIVGEWCLFNSVGCGVDTHGGQSVLNGEEGAQAETLSAEEKRALYQGIAKSQLEAWSN
GSGFYYWNYKLLTDTVNTPGWIGWDSWDLGRCIAQNWFPVPPSNL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	370	5e-141	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.88e-27	5	401	17	384	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.70e-08	56	191	22	153	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIZ14998.1	1.20e-306	1	402	1	402
QTL81279.1	4.81e-292	1	400	1	400
VEG24256.1	6.84e-292	1	400	1	400
QTL78408.1	6.84e-292	1	400	1	400
ADB10270.1	6.84e-292	1	400	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	6.63e-182	6	399	3	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.41e-181	6	399	3	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.00e-40	6	401	13	393	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	2.92e-37	4	266	7	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	4.52e-37	4	381	13	373	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	6.58e-52	6	404	42	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B8N151	3.16e-48	6	404	31	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	3.16e-48	6	404	31	398	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q5B5X8	8.62e-48	6	401	29	393	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q875R9	1.38e-43	6	404	48	430	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000756_00533.