CAZyme Information: MGYG000000756_00645

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_00645
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000756_10|CGC1	53532.58	4.5394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 12415; End: 13851 Strand: +

Full Sequence      

MSNPTNDGINLNYLANVRPSSRQLVWQRMEMYAFIHFGMNTMTDREWGLGHEDPALFNPQ
NVDVEQWMDALVAGGMTGVILTCKHHDGFCLWPSRYTQHTIAASPWRGGKGDLVREVSES
ARRHGLKFGVYLSPWDRTEDSYGKGKSYDDFYVGQLTELLTQYGPIFSVWLDGANGEGKN
GKTQYYDWDRYYNVIRSLQPNAVISVCGPDVRWAGNEAGHVRDNEWSVVPRRLRSAELTM
ENSQQEDDASFASTVRSQDDDLGSREAVSGYGDDICWYPAEVDTSIRPGWFYHKYEDDKV
MSADQLFDLWLSAVGGNSSLLLNIPPSPEGLFAEPDVESLKGLGSRINEFRKALASSCCE
VKTSSADETAMRLIDGNQDTYWSPDANDVAPAVTLTFPQLTTINAVVVEEAIEYGQRIEH
MRVTGVLSDGTECVLGQFGTVGYRRILRFDDVEVSSVTLHVDDSRFTPMISRAAAVRI

Enzyme Prediction     

No EC number prediction in MGYG000000756_00645.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	21	353	1.7e-79	0.8757225433526011

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	6.27e-71	19	471	11	425	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	8.40e-38	57	345	79	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	5.81e-34	56	345	75	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	0.005	355	407	4	51	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ29967.1	0.0	1	478	1	478
ALE12777.1	0.0	1	478	1	478
QGM63573.1	0.0	1	478	1	478
AIF89910.1	0.0	1	478	1	478
ADG99808.1	0.0	1	478	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UET_A	0.0	1	478	1	478	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UES_A	0.0	1	478	1	478	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	3.47e-318	2	478	4	480	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	8.43e-132	15	475	28	457	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.08e-102	19	472	39	459	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	7.72e-112	19	471	38	472	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	4.53e-101	19	471	40	471	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q6AYS4	7.23e-12	26	188	70	238	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	1.28e-11	26	176	72	226	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q9BTY2	1.67e-10	26	176	78	232	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000756_00645.