CAZyme Information: MGYG000000756_00648

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_00648
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1023	MGYG000000756_10|CGC1	114542.64	4.4943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 16713; End: 19784 Strand: -

Full Sequence      

MANSNRVEHASETWLTDATVFEVNRTPAHSNHKCFTHDPQSGEYSDLTQSLDGEWRVEIV
QASDIDFSEEPFVAENFDDSAFCRAQVPGHLQMAGLLKNKYVNIQYPWDGHENPLEPNVP
ENNHVALYRRKFVVSKRLADTKESGGSVSIVFHGMATAIYVWVNGLFAGYGEDGFTPNEF
DITDLLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELTAQPHVHVENMQLEADW
DAESGTASLDAALSVRNASDAATISATLKDSEGNVVWEASTNADANTTFASGSLQGLEPW
SAESPSLYELEVNVIDQAGNIVEAVVQKVGFRRFRIENGIMTLNGKRIVFKGADRHEFDA
KRGRSITEQDMIDDVIFCKRHNINAIRTSHYPNQERWYDLCDEYGIYLIDETNLETHGSW
CLPGDVVTAETAVPGSKAHWEGACVDRVNSMMRRDYNHPSVVIWSLGNESYTGDVFRAMY
KHVHDIDPNRPVHYEGVTKNRDYDDVTDIETRMYEHADVVEEYLKNDPQKPYISCEYMHA
MGNSVGNLDEYTALERYPHYQGGFIWDFIDQAIYATQPDGSTRLCYGGDFGDRPSDYEFS
GNGLVFADRTPAPKAQEVKQLYSNVHIDVTDRSVSIKNDNLFISTGGYQFVLRILADGEP
VWQSERRFDVPADSACTFDVEWPVDLYRANANELVLEVSQRLAEATDWAPAGYELAFGQT
VVAGTKAAEDAALPADGIVTVGRWNAGVQGSGREILLSRTQGGLVSYTFDGHEFVLRRPA
ITTFRALTDNDRGAGHGFERAQWMAAGRYARCVDNVIEQVDEDTLKAVYTYELATPQRTK
VTVGYTADTTGRLNLHVEYPGESGELPTIPAFGIEWTLPVQYSNLRFFGAGPEETYQDRK
HAKLGVWSTDAFKDHAPYLMPQETGNHEEVRWAEITDENGHGLRVSRANGAAPFAVSLQP
YSSFMIEEAQHQDELPAPKHMFLRVLAAQMGVGGDDSWMSPVHSQYHIPADQPISLDVNL
ELI

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	903	5e-207	0.9920212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	19	1012	21	1017	beta-galactosidase.
PRK10340	ebgA	0.0	43	1006	36	984	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.47e-150	43	902	7	803	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	7.39e-124	334	627	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	4.08e-98	749	1011	1	264	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGM63570.1	0.0	1	1023	1	1023
BAR02649.1	0.0	1	1023	1	1023
AIZ15342.1	0.0	4	1023	2	1021
BAQ29965.1	0.0	1	1023	1	1023
BAR04446.1	0.0	1	1023	1	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	2.24e-162	38	1008	26	968	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.30e-162	38	1008	27	969	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	3.90e-145	43	993	39	969	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	4.25e-141	39	993	39	973	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
1YQ2_A	1.80e-137	10	998	5	1005	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A3T0	0.0	10	1022	15	1048	Beta-galactosidase BgaC OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=bgaC PE=1 SV=1
P23989	2.62e-312	12	1021	8	1023	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1
Q1G9Z4	2.04e-293	1	1012	5	994	Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) OX=390333 GN=lacZ PE=3 SV=3
P0C1Y0	7.18e-291	1	1012	5	993	Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus OX=1585 GN=lacZ PE=1 SV=2
Q9K9C6	9.43e-271	9	1019	4	1012	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000756_00648.