CAZyme Information: MGYG000000756_01337

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_01337
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		35066.83	4.9945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 63; End: 1061 Strand: -

Full Sequence      

MANHSKHAQSSTFTVPSKSSLVKIAATVAAVGLLATGGIVSRNLYTSAERNTANQVTAFS
VTDSAEASRGNARELLNGDTSYVTVKINGKSRVVPGTNFTDVKSVLDAGDITLEPEDTVS
PSLTTKVDEKTVITIQRAGASVEVSDTAIGFNVIKKETSSLPEGQEKVETEGEEGVMETT
NLVTKSGDTVVSSNMISSYVKKAPVDKVILVGTGSTSSSSSSASASIGTTVPAGEMQQWA
HDYLLSNGYTEADFTATVYIITHESGWSVTATNPSSGAYGLPQALPGSKMASEGADWATN
YQTQLKWFWGYCAQRYGSIQGAYSYWLANHCY

Enzyme Prediction     

No EC number prediction in MGYG000000756_01337.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	1.89e-14	73	211	138	281	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	4.10e-14	141	211	2	72	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	2.54e-07	83	123	1	40	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd13925	RPF	1.15e-04	259	288	5	34	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam18013	Phage_lysozyme2	1.40e-04	240	309	6	83	Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIZ15068.1	3.92e-223	1	332	1	332
QTL81344.1	1.12e-222	1	332	1	332
BAR04155.1	3.75e-221	1	332	1	332
AZN75255.1	3.08e-220	1	332	1	332
BAR02346.1	1.78e-219	1	332	1	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.862936	0.123512	0.001390	0.001195	0.000596	0.010371

TMHMM  Annotations     

start	end
21	40