CAZyme Information: MGYG000000756_01447

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_01447
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000000756_35|CGC1	85474.52	8.839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 16426; End: 18675 Strand: +

Full Sequence      

MARIGDAEGGDRKYQWGAETSTQPLAIMHGKPSPTRVVLGYVAIICTVISWLIYMITMIL
SLFVNNPSLTLRFVVEGVLYMTIVTTLIFSALVYLVTRQGALYRFIRHERVPRAMLDDHF
AHNYNKGITVLIPSYVEQPKVVEKTIWSAALQEFPDLAVVLLIDDPPHPKNDEARAILRA
SRELMPKVLAELAAPAERFTKARDETAAALADQMDARRSVVARCAEDYRAAAQWLEHKAD
TWLVEDHTDDFFCDQVLRGLARDLRLTEQALNESITLQQHVDSNRILQLYERLVRIFIAK
GWSFERKLYASTSREGNKAMNLNSFIGLMGHSLKRVETSDGVILRDVREGESPDFVMRNS
EYVLTLDADSMLLRDYCLRLVYQMEQPGNERVAVIQTPYSSYRGAPTRIERIAAATTDIQ
HMLHQGMTYYDATFWVGANAVIRKAALDDICVVSTEGTRTVKTYIQDRTVIEDTESSIDL
GYFGWHLVNYPERLSYSATPPDFGSLVVQRRRWANGGLLIIGKFFRIVHARHQQGNDVKL
GEWALRVNYMASIAWSSFGLMFLLAYPFDQRLLSPWVVFASLPYFATMSSDLKRNGYKRS
DIFRIYGFNIVLLTVNLSGTLKSIQQGMTNTKIPFARTPKVNNRTASPALYVTMPWVIII
YSCMVFYADTFSRNWGNAVFAGFNAIVTFWALTAYIGIWHSVQDMVVGLIRWFFVPIKEP
QQEAVRKKASWRDALYFGDRQMIYESRPL

Enzyme Prediction     

No EC number prediction in MGYG000000756_01447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	362	585	2.7e-28	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13632	Glyco_trans_2_3	1.95e-28	362	585	1	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd06421	CESA_CelA_like	2.82e-21	314	521	68	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.12e-12	361	589	139	356	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	2.49e-09	361	523	86	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
PRK14583	hmsR	1.91e-06	359	556	155	333	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIZ15243.1	0.0	1	749	1	749
QTL81505.1	0.0	1	749	2	750
BAR04360.1	0.0	1	749	2	750
AZN75405.1	0.0	1	749	2	750
QGM63475.1	0.0	1	749	1	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	4.11e-08	361	516	228	374	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.29e-08	361	516	240	386	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.29e-08	361	516	241	387	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59167	1.44e-06	336	521	198	379	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
P0CW87	2.46e-06	359	630	228	494	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	2.46e-06	359	630	228	494	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
P19449	4.66e-06	359	618	228	481	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59
74	96
544	566
602	621
646	668
678	700