CAZyme Information: MGYG000000758_01107

Basic Information

• Species: Peptoniphilus_A harei
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A harei
• CAZyme ID: MGYG000000758_01107
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192		22172.4	8.9943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000758	1223939	MAG	Bangladesh	Asia

• Gene Location: Start: 4622; End: 5200 Strand: +

Full Sequence      

MKNKRAGCGCLMIILAFLGIIFFMGLLIKSTSERRAQEELNYREAYIMDTEKLATRVAKK
YGLFPSVMMAQSILESNWGRSELSQEYNNYFGIKAVKKDQGVVFETEEYVEGQSGRYMEN
FKKYSSKKESFEHYAKLLTTAKRYEKVKTANDYKEAAKYIKEGGYATDPSYAEKIISVIE
KYGLDKYDEVTN

Enzyme Prediction     

No EC number prediction in MGYG000000758_01107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	53	184	6.3e-39	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.05e-57	2	190	1	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
TIGR02541	flagell_FlgJ	1.10e-34	44	181	149	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12713	flgJ	3.07e-31	46	179	184	323	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK05684	flgJ	1.97e-30	54	181	163	296	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK08581	PRK08581	2.39e-29	44	188	321	472	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ35583.1	2.86e-128	1	192	1	192
QQE46577.1	2.86e-128	1	192	1	192
QQT90265.1	8.19e-128	1	192	1	192
CDZ75698.1	1.25e-48	28	189	26	185
AGY82036.1	3.80e-36	3	188	17	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.69e-24	42	188	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	6.17e-20	44	184	2	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.62e-20	44	184	3	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.83e-19	44	184	3	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	3.78e-17	53	181	12	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.38e-32	38	190	43	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	3.06e-21	17	188	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	3.10e-21	26	188	46	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	4.21e-21	26	188	46	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	2.29e-18	46	188	183	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.940486	0.025513	0.024156	0.000148	0.000122	0.009591

TMHMM  Annotations     

start	end
7	26