CAZyme Information: MGYG000000759_01640

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium
• CAZyme ID: MGYG000000759_01640
• CAZy Family: GT20
• CAZyme Description: Trehalose-6-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		53351.37	4.9916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000759	1836417	MAG	Bangladesh	Asia

• Gene Location: Start: 267; End: 1709 Strand: -

Full Sequence      

MSDRGNDFVVVANRLPVDLETRPDGSHTWTPSPGGLVTALSPVLESHQGCWVGWPGVADA
APEPFRTDAGVLLHPVKLTESDFEGFYEGFSNATLWPLYHDLIVTPTYDRDWWHAYREVN
LRFADEVAEVAAEGATVWVQDYQLQLLPGILRQKRPDLTIGFFLHIPFPSADLFRQLPWR
EELVRGLLGADLIGFHLEANARNFLELARRHGLDVEGEASTREVTAQIRLPQGRTIGVGA
FPISIAAKDFARFTAEDERDVAKLREELGSPQRIILGVDRLDYTKGILQRLTAFEELLET
GALNPEEVTLVQLATPSRERLDHYKATRSKVEEAVGRINGRFARVGHPVVHYQHRGVAKS
LLRSYYRMADVMLVTPFKDGMNLVAKEYVACHDDGSGALVLSEFAGAADELSQAYLCNPF
DIESVKAALLNALTALDDAPSAMSQRMLTMHQQVTEHDVQLWSQSFLGCLRQAGAEEAGA

Enzyme Prediction     

EC	2.4.1.15

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	5	471	1.5e-173	0.9726315789473684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0380	OtsA	0.0	8	478	17	485	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
cd03788	GT20_TPS	0.0	8	471	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
pfam00982	Glyco_transf_20	1.58e-179	7	467	2	465	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
PRK14501	PRK14501	2.86e-178	9	478	4	468	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
TIGR02400	trehalose_OtsA	3.98e-176	9	472	3	456	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN48238.1	0.0	1	480	1	480
QRQ67925.1	0.0	1	480	1	480
QQU82446.1	0.0	1	480	1	480
QQA98669.1	0.0	1	480	1	480
VEH73609.1	9.94e-310	1	471	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JIJ_A	2.73e-185	1	480	2	484	ChainA, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5JIO_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5K41_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5K42_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5K44_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5K5C_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_A Chain A, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_B Chain B, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_C Chain C, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_D Chain D, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_E Chain E, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_F Chain F, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_G Chain G, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile],5L3K_H Chain H, Alpha,alpha-trehalose-phosphate synthase [Mycolicibacterium thermoresistibile]
5HUV_A	1.59e-101	9	467	7	464	Structureof Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	8.88e-101	9	467	7	464	Structureof Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.03e-95	8	467	2	459	Structureof Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	1.09e-95	8	479	14	483	Structureof Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1TFL3	1.30e-181	5	470	13	483	Trehalose-6-phosphate synthase OS=Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1) OX=350058 GN=otsA PE=3 SV=1
A1KPH5	7.19e-181	6	479	20	498	Trehalose-6-phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=otsA PE=3 SV=1
Q7TWE1	7.19e-181	6	479	20	498	Trehalose-6-phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=otsA PE=3 SV=1
A4T7Q6	7.97e-181	7	470	24	492	Trehalose-6-phosphate synthase OS=Mycolicibacterium gilvum (strain PYR-GCK) OX=350054 GN=otsA PE=3 SV=1
A0R4M9	1.60e-180	6	474	14	481	Trehalose-6-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=otsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000759_01640.