CAZyme Information: MGYG000000763_00059

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas
• CAZyme ID: MGYG000000763_00059
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		48239.74	6.9925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000763	1466466	MAG	Bangladesh	Asia

• Gene Location: Start: 7820; End: 9130 Strand: -

Full Sequence      

MKYTKRLERWFVSLSEELQGRGLMRCLAMVGMSLGLLVSCAGGSTTAQQLPTHLVPMSER
ASDSLVRAASDWLSTLTIEEQIGQLIIPIWEPRYDSASRERYLRLIDQIHPGGILFRKGE
PYDQYRLTHLLQERSRIPLLITADAEWGLAMRLQGTIRYPRMKFLADHCTPEEMYTLGQH
MAQQCRVMGIHVSFAPVLDVNNNPKNPVIGTRSLGATPDIVISHGLALARGLEDGGVLSV
AKHFPGHGNTDKDSHKTLPTVSGSLEELERVELAPFRAYIEAGLGGIMVAHLSVPALEPD
VTCPTSLSHAVVTRLLREQLGFKGLIFTDGLEMRGVQRAEGLPISVAAILAGNDLLLGPL
DPLASYQELLSAYRAGTLSAETIQDRCLRVLCYKLLLHAGETSERPLYNKEELYEALHTP
ELVSFAKYLQNKVSKK

Enzyme Prediction     

No EC number prediction in MGYG000000763_00059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	132	357	5.4e-55	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	6.53e-68	77	391	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	3.07e-65	76	391	1	309	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	4.47e-44	110	352	23	273	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.75e-12	24	329	1	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12612.1	5.70e-262	1	436	1	437
QUI91552.1	1.70e-116	62	406	49	395
ATS09528.1	1.70e-116	62	406	49	395
AKV63261.1	1.70e-116	62	406	49	395
AAQ65269.1	1.70e-116	62	406	49	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	9.07e-60	76	394	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	2.70e-56	62	390	1	342	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
3BMX_A	9.84e-49	32	395	9	394	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.92e-48	58	395	3	368	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.28e-48	58	395	33	398	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.39e-48	32	395	9	394	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.86e-38	132	360	93	337	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A9M1Z4	1.11e-36	98	357	21	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
B4RQ67	2.96e-36	98	357	21	287	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
L7N6B0	6.93e-36	25	394	5	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.024473	0.247732	0.724101	0.000682	0.002403	0.000608

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000763_00059.