CAZyme Information: MGYG000000763_00585

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas
• CAZyme ID: MGYG000000763_00585
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000000763_64|CGC1	38924.44	5.1729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000763	1466466	MAG	Bangladesh	Asia

• Gene Location: Start: 5390; End: 6406 Strand: -

Full Sequence      

MNSSRMDEIRRDPTRWKRLLRYITWALWGAVLVGIVYYFVVVYRAPQAQPTHTHVIPQTE
WRDVPIAEVGASEEYEELEQYGTLYALEYLLDYDSIWPFNKLELKRYFGLYEEEEDDEED
DEVEVVEVVKVEQTKPADQPQASAEQSPEQSTRRQGVISDWDHLFQQYGNKYGWDWFVLA
SIAYQESKFRAEVVGMGGATGLMGIMPATGRRYGYSRSKLKHAESSIHVACMALRDFGRS
FAHITDSEQRMKFTLASYNSGSAHVLDARRLAENAGLDPDRWDGSVEIYMARLSEPKYYN
DPLVQHGRANGGHTVRYVAEVFSRAQSYKSKVQHATAE

Enzyme Prediction     

No EC number prediction in MGYG000000763_00585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	174	332	2.3e-19	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	9.83e-68	165	329	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	3.51e-28	155	338	265	441	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	8.18e-26	153	319	282	441	membrane-bound lytic murein transglycosylase MltF.
pfam01464	SLT	5.39e-13	165	272	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	4.46e-12	164	282	9	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	8.25e-178	1	338	1	331
BAK25352.1	8.94e-52	153	331	291	471
AUR47574.1	8.94e-52	153	331	291	471
AKV63991.1	2.45e-51	154	331	292	471
ALO29436.1	2.45e-51	154	331	292	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	2.28e-15	165	321	263	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	2.33e-15	165	321	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.33e-15	165	321	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	3.30e-15	165	321	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.30e-15	165	321	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.29e-18	164	331	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q0AQY9	4.35e-18	164	321	292	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A1U3J1	1.24e-17	164	321	289	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A0L862	1.70e-17	158	321	282	440	Membrane-bound lytic murein transglycosylase F OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=mltF PE=3 SV=2
Q4ZX03	7.34e-17	158	321	286	444	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43