CAZyme Information: MGYG000000764_00502

Basic Information

• Species: Porphyromonas_A sp900541275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp900541275
• CAZyme ID: MGYG000000764_00502
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000764_2|CGC1	38146.22	9.2269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000764	1992577	MAG	Bangladesh	Asia

• Gene Location: Start: 55808; End: 56812 Strand: -

Full Sequence      

MTRKVLALLLPLLLLTGCGSTRNAANQQVSRMPMPGKNPSYNAYIRQYAPAALQSQREFG
IPASITMAQGLLESGAGGSALAQNSNNHFGIKCHNGWNGARTYHRDDNPRDCFRVYDDPL
DSYLDHGQFLTGNRRYSSLFRIDMADYKSWAKGLQRAGYATDRGYANKLIKIIEDYQLYL
LVDGNVERDYAYNRPEQPRRTVSSKPPMRYEKPASRETTPIGVREIYKSYGLLYVLAKKE
DDLASIARDLDISEKKLTDYNDFPPGYPIEEGDIIYLQRKLRRADPPYYRHEVRVGESIH
GIAQRYGIQLRSLYQMNKLDPAYIPEEGDILILR

Enzyme Prediction     

No EC number prediction in MGYG000000764_00502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	178	2.2e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.06e-40	43	179	162	309	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	2.04e-39	43	185	45	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	4.93e-28	49	178	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	7.96e-25	20	173	123	294	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	4.51e-24	40	176	7	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ04699.1	8.61e-107	9	334	15	331
BBK92151.1	6.99e-99	37	334	27	302
QUR47394.1	6.99e-99	37	334	27	302
QIX64041.1	6.99e-99	37	334	27	302
QCY57337.1	2.82e-98	37	334	27	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.01e-11	43	173	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.40e-11	43	173	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.55e-10	43	173	4	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	1.08e-09	50	193	13	162	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.54e-09	50	174	13	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	1.77e-12	35	172	154	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	3.22e-10	20	182	212	391	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	5.36e-10	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	5.36e-10	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q9KQ15	1.95e-09	40	179	160	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000764_00502.