CAZyme Information: MGYG000000765_00447

Basic Information

• Species: Porphyromonas_A bennonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A bennonis
• CAZyme ID: MGYG000000765_00447
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000000765_4|CGC3	42546.07	7.4155

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000765	2007181	MAG	Bangladesh	Asia

• Gene Location: Start: 69877; End: 71007 Strand: -

Full Sequence      

MKYFLIAGEASGDLHAAHLMSALRVEDPRADFAYMGGAAMRERGGACVLRSEEMAYMGIV
DVLRHYPQIRRGRDAVRQSLLDYRPDVVICVDYGSFCMRYILPFVRKHLPSTKIVYFIPP
KVWAWKEFRVRQLRRDCDLIQCIFPFEVSYFRSKGVDRVSYVGNPTYEEVMHFRAHHSTD
VTSAERPYIALLCGSRLSEVRRNLPLMLESVASLGDRYRLVIAGVPSIDRSLYSEIIERH
SLQRVEVRYGETYEILSGAEAALVTSGTATLETALLGAPQVVCYATRAGRLVNFAFDHFF
KIPYISLVNLIARREVVAELFGGECTVEAIRSHLTPLLSDTTERRDMLEAYDAVSEALRT
ELPASTQAAREIVALL

Enzyme Prediction     

No EC number prediction in MGYG000000765_00447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	2.9e-99	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	5.83e-99	1	376	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.06e-98	1	376	2	375	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	3.26e-76	4	373	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.49e-62	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.09e-45	1	330	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ02201.1	2.24e-128	1	376	1	372
AVV53824.1	7.27e-107	1	375	1	372
QUI91423.1	1.46e-105	1	374	1	371
QUI89478.1	1.46e-105	1	374	1	371
ATS02318.1	2.92e-105	1	374	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.20e-32	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.20e-32	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.16e-60	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q88MG7	2.19e-57	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxB PE=3 SV=1
B0KSB2	4.34e-57	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxB PE=3 SV=1
Q1I639	6.09e-57	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=lpxB PE=3 SV=1
A5W837	6.09e-57	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000765_00447.