CAZyme Information: MGYG000000765_00453

Basic Information

• Species: Porphyromonas_A bennonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A bennonis
• CAZyme ID: MGYG000000765_00453
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000765_4|CGC4	38145.32	9.5914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000765	2007181	MAG	Bangladesh	Asia

• Gene Location: Start: 75376; End: 76380 Strand: -

Full Sequence      

MTRKVLALLLPLLLLTGCGSTRNAANQQVSRMPMPGKNPSYNAYIRQYAPAALQSQRQFG
IPASITMAQGLLESGAGGSALAQKSNNHFGIKCHNSWRGARTYHRDDNPRDCFRVYDDPL
DSYLDHGQFLTGNRRYSSLFRIDMTDYKGWAKGLQSAGYATDRGYANKLIKIIEDYQLYL
LVDGNLERDYAYNRPEQPRRTVSQKPPMKYEKPASRETTPAGVREIYKSYGLLYVLAKKE
DDLASIARDLDISEKKLTDYNDFPPGYPIEQGDIIYLQRKLRRADPPYYRHEVRVGESIH
GIAQRYGIQLRSLYQMNKLDPAYIPQEGDILILR

Enzyme Prediction     

No EC number prediction in MGYG000000765_00453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	178	5.2e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.87e-39	43	179	162	309	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.46e-37	43	185	45	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	8.08e-28	49	178	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
235559	PRK05684	4.33e-24	20	173	123	294	flgJ flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	8.75e-24	40	176	7	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ04699.1	4.01e-110	9	334	15	331
QCY57337.1	2.14e-100	37	334	27	302
QUT21858.1	2.14e-100	37	334	27	302
QUT55553.1	2.14e-100	37	334	27	302
ABR43831.1	2.14e-100	37	334	27	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.81e-13	43	173	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.18e-13	43	173	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.44e-12	43	173	4	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	5.04e-11	50	174	13	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.68e-11	50	174	13	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	3.23e-12	35	172	154	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	9.02e-11	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	9.02e-11	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
O32083	1.29e-10	64	178	71	194	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P15931	4.06e-10	30	174	144	295	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000044	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000765_00453.