CAZyme Information: MGYG000000765_01031

Basic Information

• Species: Porphyromonas_A bennonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A bennonis
• CAZyme ID: MGYG000000765_01031
• CAZy Family: CE11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		51135.82	5.1486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000765	2007181	MAG	Bangladesh	Asia

• Gene Location: Start: 2064; End: 3461 Strand: +

Full Sequence      

MTHQHTLGGSFQLEGKGLHTGKYIHLRALPAEEGHGIRICRTDLPDKPVLPALVKYATQS
DRCTTLREGDFSVCTIEHMMAALAMMGVDNCLIELDGPEAPILDGSARPYVDKILEVGLV
EQEAEAKLFVVPRKIEVCDEESGARLILLPDDTFAVDVLISYDSPILSHQFASYEWGDDF
AEEIAPARTFVFVREVQALVANNLIKGGDLDNALVIYDRELTQTELDKLSDELGVDHSDA
SKLGYISHRPLAYPNEPARHKLLDVLGDLALAGCRIRGRVIATKPGHTINGKLCRKLLEV
IEGEDKQAPTYDPEAKPLLDTQAIMKILPHRYPMLLVDRIIEMNGGKAVGLKNYSIGDPF
FVGHFPQEPIVPGVLLVESIAQIAGILVLHMVDEPGPHSTYLARIESARFRQKVTPGDTI
IFRVEALSPARHGFARVRGVGYIGDQIVCEAEVVAKVVPNQEGEK

Enzyme Prediction     

No EC number prediction in MGYG000000765_01031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	232	7.4e-71	0.8376383763837638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13188	PRK13188	0.0	1	462	2	464	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
pfam03331	LpxC	3.48e-121	4	299	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	6.65e-112	1	309	1	290	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.03e-93	1	299	1	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	6.14e-64	4	306	3	286	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ03317.1	1.27e-182	1	457	5	461
AVV53596.1	1.63e-182	1	461	1	461
AOH39727.1	1.63e-182	1	461	1	461
ATR95866.1	1.11e-180	1	462	1	462
ATR94668.1	1.11e-180	1	462	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J3D_A	5.25e-52	1	305	1	288	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	5.55e-52	1	305	1	288	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	6.20e-52	1	305	1	288	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	6.37e-52	1	305	2	289	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
5U39_A	9.76e-52	4	305	6	290	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MXT8	1.47e-179	1	462	1	462	Bifunctional enzyme LpxC/FabZ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=lpxC/fabZ PE=3 SV=1
Q8A015	6.20e-176	1	461	1	461	Bifunctional enzyme LpxC/FabZ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=lpxC/fabZ PE=3 SV=1
Q8KBX0	6.05e-115	1	461	2	466	Bifunctional enzyme LpxC/FabZ OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=lpxC/fabZ PE=3 SV=1
Q1D2K0	1.78e-60	4	298	8	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxC PE=3 SV=1
Q8YUR5	9.06e-57	4	298	3	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000765_01031.