CAZyme Information: MGYG000000766_00963

Basic Information

• Species: Fenollaria sp900539225
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Fenollaria; Fenollaria sp900539225
• CAZyme ID: MGYG000000766_00963
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191	MGYG000000766_7|CGC1	22614.23	5.1513

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000766	1523934	MAG	Bangladesh	Asia

• Gene Location: Start: 28944; End: 29519 Strand: -

Full Sequence      

MKKLIKFLIKLFLIIFVIELVYIYFIPRKYDDIIDKYSTEYGVDKSFVKAVIFKESRFKE
TAVSSKGAIGLMQLMPSTAMWLMDKLNIDDYRIEAADNNIRLGTYYLSYLMKLMDSDEEH
ALLAYNAGPENAKRWINAEGYNKNEMDNYVDFEETRKYVREIRLTRNIINFMDKYGIFLD
ELSSILEDFSK

Enzyme Prediction     

No EC number prediction in MGYG000000766_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	47	162	6.3e-23	0.7333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.61e-54	27	168	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.52e-45	27	169	3	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.74e-35	46	163	2	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.61e-28	34	140	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.37e-26	26	169	135	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM66369.1	2.40e-115	1	189	1	189
QGU94901.1	1.19e-32	2	168	5	177
QPW59871.1	2.28e-32	27	172	32	181
CDM68683.1	3.75e-32	1	172	1	179
AYF53303.1	4.55e-32	27	172	32	181

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FPN_B	1.12e-19	30	162	426	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O1J_A	1.12e-19	30	162	420	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.12e-19	30	162	416	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O24_A	1.13e-19	30	162	430	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.13e-19	30	162	436	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.56e-18	31	162	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	8.61e-17	27	188	477	638	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.95e-14	27	162	477	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.95e-14	27	162	477	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	6.26e-14	29	162	1421	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960691	0.034936	0.002615	0.000102	0.000071	0.001604

TMHMM  Annotations     

start	end
7	26