CAZyme Information: MGYG000000771_00295

Basic Information

• Species: Lactococcus lactis_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis_E
• CAZyme ID: MGYG000000771_00295
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22464.68	6.8813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000771	1762765	MAG	Japan	Asia

• Gene Location: Start: 11123; End: 11725 Strand: -

Full Sequence      

MFKKLIGLIMLILLVFGGFYVYRMHENVKHVMSYEAEVEKTLKAQGLSGDTKLALAIIYT
ETKGKQVDIMQSSESLNGKTNTFSTEEESIKQGIANLSKVLEYASEKKVDAWTGVQAYNY
GRAYVDYIAAHGAKNTIALSKAYSKDVVAPSLGNTTGETYYHLTFDSLFYNQGKLYSNGG
NIFYAKEVEWNMLLLDLLNW

Enzyme Prediction     

No EC number prediction in MGYG000000771_00295.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	7.48e-76	28	191	1	164	Lysozyme-like.
cd16891	CwlT-like	6.41e-61	34	192	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	6.40e-06	18	200	110	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTB97069.1	3.89e-139	1	200	1	200
ARE17648.1	3.89e-139	1	200	1	200
BCO05936.1	3.89e-139	1	200	1	200
AXN64792.1	3.89e-139	1	200	1	200
BBC76968.1	3.89e-139	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.97e-17	31	146	26	140	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	4.38e-15	31	146	24	139	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	5.18e-57	1	195	1	194	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
P0DC90	1.79e-56	13	199	12	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	1.79e-56	13	199	12	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q8DPY9	2.09e-56	1	195	1	194	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q8P120	2.53e-56	13	199	12	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.935322	0.029416	0.034058	0.000155	0.000085	0.000977

TMHMM  Annotations     

start	end
5	22