CAZyme Information: MGYG000000771_00333

Basic Information

• Species: Lactococcus lactis_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis_E
• CAZyme ID: MGYG000000771_00333
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		35488.46	9.6649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000771	1762765	MAG	Japan	Asia

• Gene Location: Start: 10428; End: 11384 Strand: +

Full Sequence      

MKKRVQSNKKRIRWASVLTVFVLLIGIIAIAFAAVHLLSPKANTSQKSSQTSRQEKTKST
VPSSSSQPKETKWLTGTNENQLPILMFHYVTSRADQLPQDSNNINIVTFEKELKALKSQG
YTTVSGTDAQKILTTKEKPSDKMVWLTFDDGSVTMYTDIFPLLKKYNMHATNFIITGFVN
KAQGGILSWEQIKEMKASGLVDFGSHTVSHPDLGTQTLEDQRTELEQSKADLDKNLNQQT
NMICYPAGGYNQNTLSLSTELGYKFGLLDPGRNGVVAQAAKESDGLLTLPRFRMMSSTTA
EEMMQMIQPATDYNEKNK

Enzyme Prediction     

No EC number prediction in MGYG000000771_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	136	265	5.9e-33	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	1.01e-52	143	294	1	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	6.42e-42	108	292	3	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.31e-41	136	266	1	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10973	CE4_DAC_u4_5s	1.82e-34	142	294	1	153	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	1.24e-33	82	264	1	181	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR62058.1	1.55e-33	79	267	10	206
QYR65360.1	1.73e-31	79	267	10	206
QYR68238.1	2.42e-31	79	267	10	206
QYR55309.1	1.81e-30	79	267	10	206
ALF21261.1	2.54e-30	79	267	10	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	3.44e-47	81	309	8	230	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4WCJ_A	9.56e-14	82	207	37	158	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4V33_A	7.02e-13	77	307	139	359	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
4HD5_A	1.71e-12	77	307	139	359	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
5BU6_A	3.22e-09	144	273	78	249	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	8.71e-34	41	294	24	262	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6GDD6	8.11e-14	109	266	82	249	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q6G606	1.10e-13	109	266	82	249	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	1.10e-13	109	266	82	249	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	1.10e-13	109	266	82	249	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35