CAZyme Information: MGYG000000773_01549

Basic Information

• Species: Bulleidia sp900539965
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia; Bulleidia sp900539965
• CAZyme ID: MGYG000000773_01549
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222	MGYG000000773_29|CGC2	25826.45	4.6318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000773	2056602	MAG	Japan	Asia

• Gene Location: Start: 26055; End: 26723 Strand: -

Full Sequence      

MKDLLNTIYSVLKEDMDACLQCVDDTGRFHMQENFPVFVDWSNTFDKEVCGSAITIYALR
QLIALGKQCNQNVEHYKCVLHLMEEEVRNHLYDADKHVVRCYTDEVNLATQVWMVLSSTF
TEEENHAIMQEAMHRFFPVEGIATPYMYHHITEALFVSGWKEEAIALMKSYWGKMIDLGG
DTFFEAFDPNLPDYSPYGSTMINSYCHAWSCTPVYLIYKYVL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	3	222	7.3e-32	0.43253968253968256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.18e-04	142	221	267	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE12985.1	7.86e-88	3	222	302	521
ARE15392.1	7.86e-88	3	222	302	521
QAS25318.1	8.24e-78	2	222	303	525
QTF53330.1	8.24e-78	2	222	303	525
QRG94532.1	1.16e-77	2	222	303	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	1.54e-41	8	222	328	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	1.01e-10	2	222	403	637	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000773_01549.