CAZyme Information: MGYG000000774_00019

Basic Information

• Species: Enterocloster sp900543885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900543885
• CAZyme ID: MGYG000000774_00019
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000000774_1|CGC1	46219.8	4.4228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000774	3366873	MAG	Japan	Asia

• Gene Location: Start: 18342; End: 19589 Strand: +

Full Sequence      

MANGQDFLSRGSLKIQVINIRNNFPIQNAKVSISSKGEPERVLEQLTTDSSGQTENISLP
APPAEYSLEPSIYQPYSEYNVLVEAEGFQPLNISGTEVLAGAQAIQPAKLAGDEDSTPPE
DPIVIPDHTLFGNYPPKIAEAEVKPVNESGEIVLSRVVVPQTIVVHDGAPTDSTARDYYV
PYRDYIKNVASSEIYSTWPQSTITANVLAIMSFTLNRVYTEWYRNQGYDFTITSSTAFDH
KWIYGRNIFESISQVVDEIFDSFLSRPGVRQPILTQYCDGRKVLCPRWMTQWGSCSLGQQ
GYSPIEILRYYYGDSIYINTAEQIAGIPASWPGYDLTIGSSGDKVRQLQEQLDAIAQVYT
AIPRIQTDGIYGQQTASAVREFQNIFGLPQTGVADFATWYKISHIYVGITRIAEL

Enzyme Prediction     

No EC number prediction in MGYG000000774_00019.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	3.04e-13	341	402	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	5.39e-08	332	404	117	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	6.12e-07	336	402	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92999.1	5.75e-258	1	415	1	415
ANU48790.1	5.75e-258	1	415	1	415
QQR02302.1	5.75e-258	1	415	1	415
ASN94441.1	1.16e-257	1	415	1	415
QRP40879.1	1.16e-257	1	415	1	415

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000774_00019.