CAZyme Information: MGYG000000774_02448

Basic Information

• Species: Enterocloster sp900543885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900543885
• CAZyme ID: MGYG000000774_02448
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811		90322.13	6.0847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000774	3366873	MAG	Japan	Asia

• Gene Location: Start: 12895; End: 15330 Strand: -

Full Sequence      

MKHKELLEKLTLEEKAALLSGKTVWQTRDIPRLSIPSIFLSDGPHGIRKQAGTGDHLGLN
ESLKATCFPTAAAIANSWDPVLGEEIGKALGEEAAAQDVDIVLGPGLNIKRSPLCGRNFE
YFSEDPYLSGKMAAAYIRGIQSQDVYACPKHFAVNSQEKRRMAMDAVVDERTLREIYLTG
FEIAVKEGNARAIMTSYNQVNEAYANENKELLVDILRNEWGFDGLVVTDWGGSNDHVEGV
RCQSDLEMPAPGLDSARELLRAVKEGRISQEELDLCVDQVLTAVCDLSEKKRSGEKGFDP
KTHHELAKKAAAQSAVLLKNEEEILPLKGKMKVALIGDFAFQPRYQGAGSSMVNPFEVES
MEKMIHQYDLCVVGMSRGYLRNGNADAALEKEALELAAKAEVVLYCFGLDEISESEGLDR
GHMRIPQNQINLLGELVKVNPNLVGVLSAGSSVEMPWQHCLKAILHGYLGGQASAGAVLD
ILTGIINPSGRLAETYPLRYEDTPTFRYFPASERTSEYREGLFVGYRYYDTSIVRFQYPF
GYGLSYTEFTYSGLKVDQEGVRFTITNTGKRDGAETAQLYIGFPDSAVFRPQKELKGFQK
VFLKAGESKSVKIPFDDKTFRYWNVKTKHWEIEEGEYLVMVGACVADIRLSGKLFVNGTT
KEIPYQKEQLPSYYSGLINKVDASEFEVLLGHPIPDGRWSGELGINDAICQLYYAKSGLA
RFVYRILTDKKKKSEENGKPDLNILFIYNMPFRAIAKMTGGGVSMEMVYGIVDMVNGHIF
TGLKKLVKGYFSNQKENKAYEKLLAGKEQRL

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	243	1.6e-69	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.49e-90	26	642	95	751	beta-glucosidase BglX.
COG1472	BglX	1.30e-72	25	340	50	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.23e-55	30	616	76	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.60e-50	315	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.88e-40	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR02742.1	0.0	1	809	1	813
ANU50590.1	0.0	1	809	1	813
QBE98345.1	0.0	1	805	1	805
QJU18245.1	0.0	1	807	1	811
CBL23364.1	0.0	1	806	9	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.81e-215	4	661	6	673	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.39e-177	10	664	12	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.95e-130	5	657	6	714	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.96e-129	5	657	6	714	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.43e-108	5	677	8	845	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.95e-215	4	776	6	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.19e-169	10	664	12	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.44e-168	10	664	12	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.05e-129	5	649	48	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
B8NDE2	8.18e-125	7	641	10	816	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000774_02448.