CAZyme Information: MGYG000000775_00171

Basic Information

• Species: Bifidobacterium sp900551485
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp900551485
• CAZyme ID: MGYG000000775_00171
• CAZy Family: GH33
• CAZyme Description: Sialidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	MGYG000000775_1|CGC6	83205.26	4.4045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000775	1891758	MAG	Japan	Asia

• Gene Location: Start: 204428; End: 206701 Strand: +

Full Sequence      

MNDDNNANDVVTWDCAEADDFEATVWLRFRRQTDGMMLRFAAQSEQVELELGAQQGSLVL
DSPNDHIRLDMEDTYGILLGGEHTVALTFGGFGIRVYLDGYQCFACATNLNPARFGERSA
VRTNSGVYLLGVHSGAETSEQIAVQVAASVPDVEFAAATIADFDVERMEDVHNGTIFAHF
RTRGIGQFGTVLAAAGDDGETMNVYVDDDGIRYTFRDGEQRYEYSARGSWTDGNWHDLVI
RAFRGAIDLYVDGYLELHQPGQLFFDAVHGLRKISVGADTTGVRLCGEVRNGGIFARPLT
DGEIKTLSGVPPTTDTALFDAGYEGAASYRIPSMITTANGVVIAGADQRVVIPNDAPTEI
HLVIRRSLDSGRTWLPMQTIVAFPEHGMDAPCVTDSCLTYDREHRRVIVLIDHFPGGRGF
ANAEQGVGLDDHGRLLVHDRDGAVFTVQEDGSVTGADGSVSDYRIDEQGDVTVNGAPAGN
IFAKESDDAGQSLLTARTSYLMELHSDDDGATWSKPRFISQMVKEPWMRFMGVSPGNGIQ
LSQPPYRGRILVPYYCNGTDPKHCIGGVLISDDGGETWSRGVPINEGREMNGEIVHEQTL
HDDDADTYESTIVESADGAVTVLYRNQNHAGRVGRSVSRDGGQTWDELEFVESMPEIFSQ
PNAITLPPSDDDGAWQPGEASDRMVFANASQMRPYRGRGVLRVSDDGGRTWLRHRCFNPY
HYVYQCMSVLPDGELGLLWERETAGVYFTRLPLTWLP

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	316	744	4.5e-83	0.9415204678362573

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.07e-77	316	752	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.11e-23	498	737	79	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	3.61e-10	293	645	228	606	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam02210	Laminin_G_2	2.18e-04	180	286	1	117	Laminin G domain. This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily.
cd00110	LamG	0.008	153	277	2	124	Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL55771.1	0.0	12	755	11	754
BAQ32396.1	0.0	13	755	12	751
AYZ21300.1	0.0	8	756	3	755
AHJ18498.1	0.0	12	755	11	754
AQM42305.1	0.0	12	755	11	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	1.69e-66	307	740	2	430	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	8.91e-66	307	740	1	429	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	9.62e-66	307	740	1	429	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
3H72_A	9.20e-65	309	745	4	457	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]
2W20_A	1.10e-64	313	745	4	453	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62575	8.12e-64	164	745	142	773	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	8.12e-64	164	745	142	773	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P29767	5.84e-61	164	756	212	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q27701	2.07e-28	249	741	206	730	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	2.26e-26	309	756	47	401	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000775_00171.