CAZyme Information: MGYG000000776_01397

Basic Information

• Species: UBA5809 sp002417965
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA5809; UBA5809 sp002417965
• CAZyme ID: MGYG000000776_01397
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		40361.01	7.5872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000776	1658978	MAG	Japan	Asia

• Gene Location: Start: 213; End: 1325 Strand: -

Full Sequence      

MKSPGKSIDLTHKTIVVMYMLYFGDMISITPFLEILRRAADHSKIILVIDSRFQDALRYN
PDIDEIVPFDRHGSQKSLGATWKAGRKLAEQNPDILITLHGTARTSVMAWAMHPRFWAGE
AGTEIDRFLMDLPMTIETYDCHAVDKYIHVLQRMGVQDLKHSGMKTYTCPGWEKEADEFF
TASGIQPGERLAGFSAGSSTPEKNWPAEKFGQTADFFAGRGYRPVFFGIESEKGLVSRAV
SAMSRKGAVSAAGKLSMGGFIAAAGRCSLFFTNDSGPMYVADSRGVPTIAMFGPSNAKFH
HPLGPFSTALSSWDMPEGPEHVNQNIKTGRYVPIENISVDDVIGAGLAAEKKAGIIHSGG
ASGTKSQSEK

Enzyme Prediction     

No EC number prediction in MGYG000000776_01397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	306	4.4e-38	0.8711111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.48e-51	14	345	1	274	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.18e-36	12	352	1	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	9.09e-22	82	326	2	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02201	heptsyl_trn_III	1.18e-18	15	345	2	338	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.39e-12	9	345	2	338	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25206.1	1.95e-167	1	353	1	354
AXL20515.1	4.29e-89	8	346	2	338
AXB80808.1	2.49e-86	8	345	2	337
ALG42175.1	2.60e-82	8	346	2	338
AVO27634.1	2.60e-82	8	346	2	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.37e-72	9	345	5	340	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000776_01397.