CAZyme Information: MGYG000000779_00530

Basic Information

• Species: Prevotella sp000431975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000431975
• CAZyme ID: MGYG000000779_00530
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000000779_20|CGC1	63701.96	7.3651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000779	2667664	MAG	Denmark	Europe

• Gene Location: Start: 100; End: 1809 Strand: -

Full Sequence      

MKHFGKLILGACTALTLTGTPAPVLAQSLSPSTQWEWNKGTIVVKSPERPAGQKCALGLT
VPKMKVVRVGFVGLGMRGPGAVERFTHIAGTKIVALCDYEKDRAERCQKYLQKACLPEAA
IYSGAEGYKALCERNDIDLVYIAADWDHHFPIAKYALQHGKNVAIEVPSAMNLEQCWELI
NLSETTRKHCMILENCCYDWFEMNTLNMAQHGVFGEILRAQGAYIHNLDEFWPYYWKNGK
EDKLGWRLRYNMENRGDVYATHGLGPVAQALNIHRGDRMTTLVAMDTKSVHGKALVEKAT
GEPCEEFRNGDHTTTLIRTAQGKVIEIQHDVMNPQPYNRLYQLTGTKGFANKYPIEGYAV
DANQMKASGVQPKVDNLSSHSFLPEKEMQALVDKYQHPILKKYGEMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCSLAELGALSMDNGCAPVAFPDFTRGHWNDVKGFHH
AFATPAEEAATELTAETATLSLKTQGMKEWLAKSKKSDVKKEDVESHIQQLSAQLEKTRR
KANGSENKELKETEKQAEKMLKQAQKLLK

Enzyme Prediction     

No EC number prediction in MGYG000000779_00530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	5.5e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.79e-20	64	393	1	303	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.63e-11	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.33e-07	67	188	5	116	putative oxidoreductase; Provisional
PRK10206	PRK10206	6.27e-04	135	185	63	113	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24012.1	0.0	1	512	1	513
QCQ31109.1	0.0	6	510	7	511
QPH58140.1	2.13e-305	8	513	14	512
QUT62233.1	3.03e-305	8	513	14	512
QQA30686.1	3.03e-305	8	513	14	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.40e-85	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.71e-64	65	476	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	4.56e-07	66	273	12	191	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	9.11e-06	103	234	39	167	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	2.22e-303	1	516	1	517	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	9.50e-297	7	516	8	516	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	1.06e-244	6	503	5	498	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	6.73e-212	44	483	38	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q5LGZ0	6.97e-210	2	483	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000286	0.998999	0.000202	0.000188	0.000159	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000779_00530.