CAZyme Information: MGYG000000779_00868

Basic Information

• Species: Prevotella sp000431975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000431975
• CAZyme ID: MGYG000000779_00868
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000000779_37|CGC1	63279.2	9.7813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000779	2667664	MAG	Denmark	Europe

• Gene Location: Start: 18937; End: 20589 Strand: -

Full Sequence      

MNISRRLNEETIWLLFLCLAAFFINNSSLPTDIMETRNIVTAREIVADGNWLVPTMNGVL
RIEKPPLPTWIAAVVETLNPRDLSTQRSAAGLAAAMWTMFLYFVGKYTTRRRDYAFISTL
VFITCYNVILMGRSATWDIYCHAFMMGGIYYLMRLLYDDRYYAHSHKWRWGLLAGVFMGL
SFMSKGPVSFYALLLPFLIAMLYSVRPTMRGKGGPLALLIILTLVLSSWWYIVLWITHPE
MLHYVLNKETGAWSNHNVRPWYYYWRFFSEMGAWALLTLAALIVPYWKKRVPQPRQYTAA
VVMLVSSLVLLSLMPEKKMRYLLPMCVPVAYSVAHILLYYKDRHVWDRFADLLFKINGTI
VALVIVAMPVLIHLFVYGRGIIDHGTAIFVDVLCLAVLWYLIRSMRLHKIIDMVNSVAIL
FLIAECFMIKSIGMAFGNPDKHSIHEVVKQENVKHLPFYHPASEDLRIEMVYQAGRKILP
VDVNNLNDIASKAPCVLVTREPLSQAIPAKVLAHLDTIKVAQCDDNVHPKSNKHYSRQFL
NQISIVKVKK

Enzyme Prediction     

No EC number prediction in MGYG000000779_00868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	9	421	1.5e-61	0.7685185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.68e-26	12	403	11	404	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.14e-11	64	231	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.83e-09	35	264	33	261	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	4.10e-04	63	205	61	200	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	0.009	100	210	126	239	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADT96617.1	1.22e-19	3	402	4	415
AAN57649.1	1.62e-19	3	367	4	376
QKG94929.1	1.62e-19	3	367	4	376
VEF28115.1	5.07e-19	3	402	4	415
QQK62015.1	5.07e-19	3	410	4	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	3.31e-14	15	334	16	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A1JPM4	1.79e-13	15	378	14	379	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q4ZSZ0	2.35e-13	35	364	34	360	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
C6DAW3	7.33e-13	6	390	7	394	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
Q2NWA9	7.36e-13	19	396	12	400	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.900309	0.096150	0.000888	0.000580	0.000410	0.001669

TMHMM  Annotations     

start	end
12	34
88	105
114	131
135	157
170	184
188	205
214	236
262	284
297	316
321	340
353	375
380	402
414	436