CAZyme Information: MGYG000000779_02118

Basic Information

• Species: Prevotella sp000431975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000431975
• CAZyme ID: MGYG000000779_02118
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		47357.79	9.9825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000779	2667664	MAG	Denmark	Europe

• Gene Location: Start: 268; End: 1506 Strand: -

Full Sequence      

MKHTTEMTCYPSCRTSLVSVALLLWVLLLLDACTVHSGDVRMKRLSDSTVYTGQLVDGRP
EGWGVLMQGDSVVYEGQWANGLRQGKGRAADSIGRRIEGYWKADTLVRGKRTDADGVYVG
MFDRQQRASGHGAYIDSLQRYYEGHWERDKRNGFGFSSESRYFRVGEWKNNVYKGERLNY
TSERIYGIDISKHQHVIGKHRYGIDWDRLRISHLGSLSKKNVSGKVDYKVSFIFIKSTEG
RTVRNPYYAGDYEAARAHGFPVGSYHFFTTSSTGAQQAAHFLKYSHFKKGDLPPVLDLEP
TSSMIRKMGGTVALFREVRVWLRTVERRVGVRPILYISQIFVNRYLPSAPDLKENYPVWI
ARYGEYKPDVKLWIWQLAPDGRVRGIHGTVDINVFNGYQTEFQQFLDKERIK

Enzyme Prediction     

No EC number prediction in MGYG000000779_02118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	188	386	1.7e-39	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	2.04e-49	186	397	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	3.89e-46	185	397	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	4.96e-42	186	395	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.56e-34	188	386	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	4.66e-32	185	402	63	263	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29361.1	1.61e-176	21	412	23	413
ALO48884.1	1.17e-149	51	411	41	402
VEH15425.1	1.83e-140	48	410	38	379
QUB47627.1	1.35e-136	36	406	33	402
BCS86499.1	3.48e-135	91	411	36	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	5.18e-14	230	397	27	204	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
3HMC_A	4.96e-09	211	397	4	181	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	3.74e-33	181	407	63	266	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	1.01e-32	181	407	63	266	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	1.95e-32	181	407	63	266	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
P25310	8.18e-13	230	397	104	281	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	9.29e-13	212	395	7	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000684	0.980402	0.018231	0.000236	0.000213	0.000201

TMHMM  Annotations     

start	end
13	35