CAZyme Information: MGYG000000781_00034

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_00034
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	MGYG000000781_1|CGC1	61384.73	5.3011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 40881; End: 42518 Strand: +

Full Sequence      

MRKSVSFLGILAFVSCTSGVEMMGQEGNPDGDFTDLPVTDKIVSSYIRSNFFQTNRISAK
SMNACNDLILLGVNPYADGSLFFEIPDNTVAFSNEKYLPEFREREGVISFDGNGEMNAGN
DLLHTPVIWGNAESGKCNQFTFGTWLYVDEWTQGACLFLKDNGSHRIALKEGARKGEFVF
EVDSREVTLTASGFETEKWNHLALTYSVTANNKGIHLYVNGKKAASDLSWGDKLPFVRTQ
MKLAKGFKGKLDETFFNGLPLSENEVQKVMEKAIDFSTWNMSKTLAYWKYDDAESYGKDS
HTWVEIMKQVKAQLSAKNIKFRVGVTAGDWKTMCAKEVYRDSFVKNVVKLVGQYAFDGVD
LDFEWPLNKEEFDNYSKTIVELKKALGKGSVLTVSLHPLYYTISKEAIQAVDHISMQCYG
PSVDRFPYDTYVKEAQEVLKYGIPKEKLVMGLPFYGAAEGKQGTVAYWNLVQENLIDRPD
KDEVVYQGKKYVFNGASTIVRKTQYVMDNDLAGVMTWDLATDVPWENPWCLTKVMVETMA
SPAAH

Enzyme Prediction     

No EC number prediction in MGYG000000781_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	284	529	3.5e-37	0.8074324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	4.36e-27	305	522	55	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.08e-26	308	522	51	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	1.41e-26	280	522	40	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	3.74e-19	332	522	89	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
cd00598	GH18_chitinase-like	5.11e-19	286	519	32	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17915.1	8.44e-142	30	536	303	811
QQA10039.1	1.79e-137	24	539	42	545
QMW88601.1	1.79e-137	24	539	42	545
AAO76739.1	1.79e-137	24	539	42	545
ALJ40996.1	1.79e-137	24	539	42	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	1.28e-19	327	522	91	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
3CO4_A	4.86e-15	307	527	54	289	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
6JM7_A	3.06e-11	314	522	69	350	Crystalstructure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	2.98e-10	314	522	69	350	Crystalstructure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
6BT9_A	2.63e-09	291	522	121	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W092	2.58e-13	283	522	88	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
Q5AM60	6.81e-10	313	539	94	372	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1
O35744	1.61e-08	314	522	83	365	Chitinase-like protein 3 OS=Mus musculus OX=10090 GN=Chil3 PE=1 SV=2
Q91Z98	1.63e-08	314	522	83	365	Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
P36362	2.07e-07	315	456	92	271	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000757	0.280192	0.718680	0.000126	0.000113	0.000109

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_00034.