CAZyme Information: MGYG000000781_00640

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_00640
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		68738.44	8.9953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 24748; End: 26559 Strand: -

Full Sequence      

MRKMKFIQTICLSLALMAGSPNLTVQAQKSAEYFLHTVTKGQSLYSIASMYNVSVDDIVR
INPGSKELIREGQSLKIPQKSDNNSQQGQFHTIQAGETLYQLTVKYNITAEAICKANPGL
SASNFRIGQVIVIPPQNSTEIAIQEEITKELAAAETPKKEWKDMHKVQRKETIFSISREY
GITEEELIAANPELRTGKLKKGTFLFIPYPKQSESTATSDILSQGKTPSNEELFSKNSVA
PKRYQTIRTALILPFSSSRAGASEEQSRMVEFYEGFLMAADSLKRQGISLDIHTFDSKGK
ASEVNAILAQSKMKEMDIIFGPVNQEAIPLLADFADKHDIRLVIPFSPKVDQVFKNPHIY
QINTPQSYLYSEVYEHFIRKFGRSNVVFVEDGSSDSEKAEFIKGMKNGLKEKGISYKQVR
IGTEIDPTKVIAAMDTLQENIFIPTSGRSSALNKILPHLTMVRREHPNFNMHLFGYPEWQ
TYTQDFLANFYELDTYFYSSFYTNNLFPAAIQFTHAYRRWYSKDMANTFPKYGMLGFDIG
YYFLKGLAQQGNKLEENLNRIQVTPIQTGFKFERVNNWGGFINRKVFFVHFTKDFELIKL
DFE

Enzyme Prediction     

No EC number prediction in MGYG000000781_00640.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.36e-10	89	133	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	1.59e-10	36	77	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG3858	YaaH	3.38e-09	33	141	1	102	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam01476	LysM	8.84e-09	91	134	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.45e-08	90	133	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25583.1	5.62e-306	4	603	1	601
ALA74972.1	4.37e-253	4	603	1	602
QJR68229.1	2.51e-252	4	603	1	602
QJR60047.1	2.51e-252	4	603	1	602
AII69224.1	2.51e-252	4	603	1	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	2.73e-07	36	117	29	117	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
O05495	1.03e-06	34	134	2	93	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P44493	1.40e-06	36	202	294	424	Probable N-acetylmuramoyl-L-alanine amidase AmiB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=amiB PE=3 SV=1
P0C1U7	1.82e-06	15	191	8	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q2FJH7	1.82e-06	15	191	8	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain USA300) OX=367830 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000801	0.978266	0.020165	0.000259	0.000244	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_00640.