CAZyme Information: MGYG000000781_00726

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_00726
• CAZy Family: GH18
• CAZyme Description: Endo-beta-N-acetylglucosaminidase F2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000000781_9|CGC1	35892.31	4.5786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 35311; End: 36267 Strand: +

Full Sequence      

MRKILYFLALCFSTALVACDEQTTPEALDVQVPPTKSEDYFEALRAYKQSKHQVSFGWFG
NWTASGTAMSTRLDNVPDSVDIISIWGNTFNLTPAMMEDMAYVQQKKGTKVIFTIFAHTV
PELFIAEDGTIDYASYAKSLNDTIVKYNYDGIDFDYEPNYGGSGPLCNKDNMETFIHEMG
KYVGPKSGTGKILSIDGEPYYMNPGLSEYFDYGIVQAYNSNGDSDLQGRFNRAADVGWRP
EQYIFTENFESFWQSGGNPNYVDKYGNVMPSLEGMARFNPTQGPKAGVGTYHMEYEYLAL
PTYKYLRKAIQIMNPTVK

Enzyme Prediction     

No EC number prediction in MGYG000000781_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	55	224	2e-16	0.527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	3.57e-74	23	312	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	1.29e-57	53	297	1	242	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd00598	GH18_chitinase-like	5.86e-13	77	221	34	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
pfam00704	Glyco_hydro_18	3.57e-07	104	222	59	179	Glycosyl hydrolases family 18.
cd02871	GH18_chitinase_D-like	1.93e-06	57	223	5	198	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH55047.1	2.48e-139	1	317	1	321
QIU95223.1	2.22e-120	7	315	13	318
AFL77898.1	2.05e-106	1	315	1	329
QZE14615.1	2.03e-105	15	318	18	328
BBL06359.1	2.06e-102	1	315	1	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	3.23e-44	34	314	53	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	1.43e-13	47	315	24	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	1.62e-12	47	315	24	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	5.67e-20	1	315	1	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000105	0.113535	0.886248	0.000039	0.000051	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_00726.