CAZyme Information: MGYG000000781_01080

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_01080
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000000781_15|CGC1	58015.1	9.5354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 21220; End: 22752 Strand: -

Full Sequence      

MKKKIHLLLCMWGLLGTVSGQNVKYVDPFIGTQGTGHTFPGPSLPFGIVQPGPDCNSTSW
DYTSGYQYADSTLLRFSQTHLSGTGIGELGDVLLLPFADNEKKGILKKHTEKASAGYYSV
EKADGVKAELTCTHRVAFHRYTFPSANASLLLDFQHGIRFLTDSLVLHSDIQIKDKHTIT
GYCHTKNWVERKYFFVIKFDTPFSSMEQLPLQAKENAPRYVAQFKLKSKHPQLKVKVALS
TTGMKGAEKNLQQELPHWDFEAVRKQASDQWSRYLDKIQIETDERRKRIFYNCMYHLLLQ
PSNIADVDGRYRGVDDQVSCAEHKAYFSTLSNWDIYRAAFPLLQFIAPEVIDPIVRSMIV
HHQKAGFLPIWTAWGKDNYCMIGNHAIPMIVSAYQNGFSGFNPEEAFAAIQETSTTPHIH
SDWDTYRKYGYYPFDLVKDESVSKASKTDTTTGAWPSWLRNSRRRRSAKNSIKEPVFMKI
CSTVTPSSSGERIRKGNGEPISIRSRPRLR

Enzyme Prediction     

No EC number prediction in MGYG000000781_01080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	221	445	1.4e-63	0.4663951120162933

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07971	Glyco_hydro_92	2.61e-79	246	445	1	205	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
pfam17678	Glyco_hydro_92N	6.32e-74	25	240	1	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
COG3537	COG3537	2.34e-72	22	443	43	480	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
NF035929	lectin_1	1.70e-51	26	348	11	372	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCB70531.1	5.39e-197	2	444	5	446
QKJ64439.1	5.51e-177	19	444	24	450
QWG04805.1	1.29e-168	24	444	33	453
QNL41379.1	5.74e-145	18	448	27	465
QDH54207.1	2.60e-140	1	444	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	3.13e-91	19	443	4	445	Structureof the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6F91_A	3.14e-70	25	444	10	454	Structureof the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2WVY_A	6.89e-36	23	479	8	477	StructureOf The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_B Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_C Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_A Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_B Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_C Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
2XSG_A	1.60e-24	19	456	6	491	Structureof the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans],2XSG_B Structure of the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans]
4AQ0_A	1.63e-24	19	456	22	507	Structureof the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans],4AQ0_B Structure of the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	3.07e-38	23	433	42	475	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1
D4ATR3	4.09e-16	19	303	27	351	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999126	0.000165	0.000153	0.000147	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_01080.