CAZyme Information: MGYG000000781_02469

Basic Information

• Species: Phocaeicola sp900541515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900541515
• CAZyme ID: MGYG000000781_02469
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		18544.35	9.6849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000781	3237958	MAG	China	Asia

• Gene Location: Start: 129; End: 599 Strand: +

Full Sequence      

MMVKDTLIVRLDNQKELDDNSRNSDRKASLKREQQKNVDDIIKAENQLPELTIPNLYKEI
IRNRILYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTESVRAYYTK
VQYKYKVGNYLLWLDEIGYAEDPNYIIAVIRILKTL

Enzyme Prediction     

No EC number prediction in MGYG000000781_02469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	57	155	2.9e-17	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	2.68e-15	54	118	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.41e-11	66	154	28	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	1.13e-10	66	151	63	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.00e-07	72	96	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	9.06e-05	4	108	269	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT57866.1	5.70e-108	2	156	1	155
AKA52216.1	1.03e-100	1	156	56	211
QUT98797.1	1.28e-94	1	156	56	211
QJR77087.1	2.78e-84	1	156	56	211
ALJ41751.1	2.78e-84	1	156	56	211

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000781_02469.