CAZyme Information: MGYG000000782_01790

Basic Information

• Species: Phascolarctobacterium_A sp900541915
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900541915
• CAZyme ID: MGYG000000782_01790
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		61146.24	8.811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000782	1798867	MAG	China	Asia

• Gene Location: Start: 1644; End: 3245 Strand: -

Full Sequence      

MEKAYKYIFWLSAVLLLFFCNNDLLITDSVESNYALTAKEMVLSGDWISPQIYGHYWFDK
PVMFYWLTALAFKVFGFTEFAARFFPALFGLAALGLIYWGGSKLYNERTGFYSSMILLSC
LEFFLISKSIITDAVLFLFFSGTLLFFYLAYTSHSSRYWYLMYICAALATLTKGPIGFLL
PGLIITLFIIWQKEWRLPFRMHLLTGTALFALLVMPWYGMMIYLHGAAFIDTFLGTHNFL
RATVSEHPRDDVFYYYTVVNMLAFFPWSLLLPMIIYRAWRENSFIVSVREKFLLIWAAAV
FVFFQCMATKYITYTYPMLFPGALLLGGYLTEYEEILKKKIFLRLLAGTFIFLVIAGYWT
VNKGLVSGTMLFLLPASLGVGLFIYFCLRKYVSGNFISIGLGSVIFYLTLTMCIAVPFSS
QRSAKDLAILLPQYTNADSVGVYGHYPTSAVFYSGKQFVKLLPAKSAANFSPQAYSWNSK
NVMPYAAIEQEMYPLVVVSSKYEADFLALDTSEWNEELKLSNWIVMRKMVHTG

Enzyme Prediction     

No EC number prediction in MGYG000000782_01790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	462	2.9e-104	0.8722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.36e-50	13	461	17	480	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.55e-32	1	342	2	345	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.02e-21	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.30e-11	31	218	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	0.008	63	173	68	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	1.09e-202	1	527	1	525
AEQ23377.1	7.24e-137	1	528	1	543
ADB46704.1	3.42e-132	1	528	1	544
AVO27725.1	2.72e-113	13	528	35	508
AVO74995.1	3.85e-113	13	528	35	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.73e-22	31	328	59	361	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	1.04e-24	31	342	30	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.39e-24	31	342	30	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	1.14e-22	22	332	25	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
O67270	3.67e-22	6	339	4	328	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B2VBI7	1.53e-21	31	327	32	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993185	0.006678	0.000105	0.000013	0.000012	0.000036

TMHMM  Annotations     

start	end
7	26
80	102
123	145
160	191
203	225
252	271
292	309
313	330
342	361
365	387
396	418