CAZyme Information: MGYG000000782_01806

Basic Information

• Species: Phascolarctobacterium_A sp900541915
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900541915
• CAZyme ID: MGYG000000782_01806
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000000782_25|CGC1	24367.94	8.7608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000782	1798867	MAG	China	Asia

• Gene Location: Start: 1070; End: 1690 Strand: -

Full Sequence      

MAGRKRKSSRNKGNSKVRKYFHVLICFLLLVFGYGGWRLWNSDAVQMRFVYMWPYQQDIL
EYSQRNNIDPFLIAAIIKNESGFDPKAVSAVGAVGLMQIMPETGRWIAEQMGLENYQDND
LYQTKKNIRMGCWYVGELEHEFQRNLALIMIAYNAGRGQTKAWMEENGWDYNFNDLDAIP
YPDTKEYVIKVLHDRDRYYLLYKDRL

Enzyme Prediction     

No EC number prediction in MGYG000000782_01806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	60	194	3.2e-28	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.25e-74	53	197	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.93e-51	54	205	5	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.68e-33	70	192	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.42e-29	59	169	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	7.68e-27	54	206	138	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	4.98e-113	5	206	4	205
BBG64618.1	4.08e-97	1	206	1	198
QNP77119.1	2.80e-95	18	206	23	209
ADB46849.1	9.59e-67	23	206	16	196
AEQ23289.1	1.32e-66	19	202	12	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.55e-24	51	202	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.57e-24	51	202	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.59e-24	51	202	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.61e-24	51	202	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.63e-24	51	202	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.83e-15	38	199	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	8.12e-15	51	192	1418	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	8.12e-15	51	192	1418	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	1.23e-14	64	205	437	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	6.71e-14	59	191	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42