CAZyme Information: MGYG000000784_00819

Basic Information

• Species: CAG-417 sp000432835
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-417; CAG-417 sp000432835
• CAZyme ID: MGYG000000784_00819
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	MGYG000000784_10|CGC1	100102.37	8.8516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000784	1269692	MAG	China	Asia

• Gene Location: Start: 16309; End: 18885 Strand: +

Full Sequence      

MNILGRNYIKSSGKLKVVREKNKIIIENNSDIKQKLIFYKSIRTDNKKLTINSVSNIKAE
ENCTIKILNRKFRVIQSVDMNTKSFFSNLPKKVFIGLSILPNAKIEIDSLEVSFEKEDVS
INEYFSGNILLICPGYPMVKNKYLFSFIHSRVQAYKENKLNVDVAVVHSEYIEKTEFATF
ENVDYIRTGYNQIRNLLQVRKYDKILIHFFDPAYFQLLEPQDLSNTQIILYSHGTDALYR
AFDVIGRPYFVSDYVVPESFTKTFALRDYYIKKYNNLPNVKFVFVSNWAKKMSEELLKIK
YNNAEVIPCFIDERQFPYTEKDPELRKRVFVLRKFDDLSTYSIDIDVRVILELSHRKCFN
DMEFSIYGDGGIHDKLVEPLRKFSNVHIYRKFLSHDEIKMMQKENGIGLFATRFDTQAVS
SCEAAMAGCVVVSSKNVGTCEYIDPKIGAFCETENIIEYADLIEELYNDPKLFKTMSEKM
HDSVMKTCSYKYSIKKDMDMILSFDKTEKIKVPDIKKNPILSIVIPSYNVGKYIKGGVKS
LLRSKYASDLEIIIVNDGSKDDTVAKSNELLSNYRGKNPIIKIIDKENGGHGSTINKGIE
IATGKYFRLMDGDDYYITENLDKLLEKLKDEDSDIVLTNYIEDFAVTAVYNPTKFYPNLV
PGVQYNLDEMYYNGNEYGFIMFGPLLPTSTYKTSILKNANFKIDEHCFYVDMEYNLVGYI
NAKTVSYYPFDIYNYYLGRQGQSISKESYKKNILHHEKVCLRLVDYYTEKEKELSESKKA
YLNNCIIVPMCKRQYELTTEMFKNNEHFISFDRKLKKYPQFYNNTSIAGRRVKIHRLTNG
HFIWMNDVFIKLGKLIRR

Enzyme Prediction     

No EC number prediction in MGYG000000784_00819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	522	671	4.3e-29	0.7764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.41e-27	522	673	1	148	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.04e-22	523	638	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10073	PRK10073	9.23e-20	519	639	6	121	putative glycosyl transferase; Provisional
cd04179	DPM_DPG-synthase_like	3.23e-19	523	637	1	113	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06423	CESA_like	6.93e-19	523	699	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67183.1	9.55e-203	2	854	5	863
AJC12300.1	9.03e-71	65	503	68	511
QKF06692.1	3.97e-68	126	704	14	588
QWG53197.1	1.12e-57	173	503	6	331
QWH36998.1	1.12e-57	173	503	6	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.87e-14	520	703	6	185	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	8.77e-14	519	615	5	96	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z86_A	1.45e-13	504	654	360	493	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.45e-13	504	654	359	492	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
6P61_A	3.57e-09	516	615	10	104	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71059	9.70e-20	519	735	3	211	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
A0A0H2UR96	6.04e-14	520	640	4	120	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71057	2.38e-13	517	735	2	211	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q8L0V4	8.64e-13	504	654	417	550	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
Q7BLV3	1.08e-12	504	654	425	558	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000784_00819.