CAZyme Information: MGYG000000788_00310

Basic Information

• Species: Bacteroides pyogenes
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides pyogenes
• CAZyme ID: MGYG000000788_00310
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772		87253.76	8.8603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000788	2895183	MAG	China	Asia

• Gene Location: Start: 53838; End: 56156 Strand: +

Full Sequence      

MKNNLLKFFKDLSAARKASIGIIAFLVAGYVFCLPQELFKVPYSTVVTDRNDELLGARIA
SDGQWRFPPRETTPEKMKRCLVAFEDKHFYSHWGVNPFSIGRAVYQNIKNRRVISGGSTI
TMQTIRLVRNNPRTIGEKLIEMIWATRLEFRASKEKILSMYISHAPFGGNVVGLDAAAWR
YFGHSPEDLSWAEAATLAVLPNAPAMIHLSKGRKELLSKRNRLLKQLFEQKNFDRSTYEL
AVSEPLPDAPHPLPQTAPYLVSRFYKERNGMYSRSTIDRGIQMQIEELAERWSREFSRSD
IRNLAVLVIDMRTNEVAAYCGNVHYHKKQQGNQVDVIQAPRSTGSILKPLLYNAMLQEGT
LLPDMLVPDIPININGFTPQNFNMQFEGAVPASEALARSLNIPAVTMLQRYGVPKFHRLL
QQAGFTTINRTPSHYGLSLILGGAEASLWDVTNAYARMGRSLLRLPQNRCKLLSSETEAN
EDTEFFMPGAVWQTFDALKEVNRPEEIDWKSIPSIQTVAWKTGTSYGFRDAWAVGVTPRY
TVGVWVGNATGEGKPGLVGAQTAGPVLFDIFNLLPASKWFERPTGVFVEAEICRRSRHLK
GRFCEETDTALILPAGARTEACPYHHPVTLTADEKHRIYETCADTEPTIRKSWFTLPPVW
EWYYKQYHPEYKPLPPFKPGCGEDFFQPMQFIYPSPNARIKLTRQMDGSGGFITVELAHS
NPQATVFWHLDGSYETQTEDFHKISLKPSAGKHSLTVVDNEGNSVSTSFLIE

Enzyme Prediction     

No EC number prediction in MGYG000000788_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	69	227	1.6e-47	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	38	772	5	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	41	772	33	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	1.36e-130	61	772	57	772	penicillin-binding protein 1C; Provisional
COG0744	MrcB	3.73e-98	18	572	25	594	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	7.08e-98	74	566	11	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW87228.1	0.0	1	772	1	772
AAO75269.1	0.0	1	772	1	772
QQA07103.1	0.0	1	772	1	772
ALJ42737.1	0.0	1	772	1	772
QUT70422.1	0.0	1	772	1	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	1.93e-33	50	548	139	668	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.09e-33	50	548	160	689	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	9.99e-31	50	548	143	672	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2OQO_A	4.29e-27	74	244	29	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.47e-26	74	244	29	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	6.20e-105	35	772	33	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P40750	7.86e-38	49	550	60	599	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q9KUC0	1.28e-37	61	548	176	689	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	1.62e-37	18	547	23	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P45345	4.10e-36	35	572	123	702	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34