CAZyme Information: MGYG000000788_01427

Basic Information

• Species: Bacteroides pyogenes
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides pyogenes
• CAZyme ID: MGYG000000788_01427
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943		106578.4	6.1131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000788	2895183	MAG	China	Asia

• Gene Location: Start: 28666; End: 31497 Strand: -

Full Sequence      

MNRNILFFYFLFLCLLNIGCSSSDDGLSAPTITVGKEVVDFENGAGVQEVSVKTNITGWS
ATADKSWCHPTPSGNFLRISVDESNDRLVREAIITLTFDKQTKTIKVRQLGYEPAILIDQ
QIFLLNASGGNIKFTVTANVKVGIEGVPEWVKPTSRTRAPEMVSTDYSYTVGASTNEQSR
EASIEITEILDAGVNDIAPKKALIAITQKGLGNYEAEPGDEIKDDIKIRVVSGTASSFQQ
GQNIEKSFDGDYTSLYHSNWDNKPENYFPIHLVYNFEELSTVDYLVYHPRSDGNPNGRFK
EVDIEYSEDGSFFKPLMSKVLQNVAHATKMEFPKSVQAKSFRFTVKSGFGTGKGFASCAE
MEFYVKNPENFDYSTLFSDQTCSDLKPGITEEEILKCEYPFFKNIAYHMLKGKYDREFRI
DEFKAYPHPDIMARTHKTNAYSLLDNPTGISVKENETIIVFVGDTHGKTISLRVQNLDKP
KGDGFGGTYYALNPGVNKLRMSTKGLVYVMYHTSTIEEADNAQPIKIHFASGSVNGYFDS
NKHQPSDWKRLLDKAVDPYFDLVGKYAHLTFPTYRFRTLTPDGKALIDAYDLLVNSEMEF
MGLYRYDKVFRNRMYFNVMYHSYMYATWYHTAYHDDTLQQLCDVNKFKAAPWGPAHEVGH
CNQTRPGFKWLGTTEVTNNVMSLYIQTSVFDRPSRLQTENMGNGIRNRYSKAWTSLVAPR
PQLSYSSFGDNDVFCKLVPLWQLELYFGKVLGRTPLQQSDKGGFYPDVYEHVRTHSDLPT
AGEQQLEFVYIASLKAQKNLIGFFKKWGFLTPVDVEIDDYGKGRMKITQSQVDNIIKRVN
DLGFPEPDVALEYITDNTVEVYKTKADIIPGTATRSGQVLTMTNWKNVVAYEVVNEEEGK
MVCISDGVLEASSIATFDVRTPWQSSFKVYAVSATGKRVEVVL

Enzyme Prediction     

No EC number prediction in MGYG000000788_01427.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	1.09e-62	532	808	1	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
cd14948	BACON	1.05e-15	31	109	1	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam00754	F5_F8_type_C	7.21e-13	234	361	3	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam19190	BACON_2	2.14e-08	32	112	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
cd14948	BACON	1.48e-06	115	209	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT79445.1	0.0	15	941	16	937
QRP89238.1	0.0	15	941	16	937
QUU03487.1	0.0	15	941	16	937
QRM71921.1	0.0	15	941	16	937
QTO25368.1	0.0	15	941	16	937

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	3.16e-64	376	856	14	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	3.32e-58	375	939	33	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7BLG_A	1.13e-56	223	366	20	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	2.24e-55	408	939	20	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q921K8	7.25e-11	505	818	613	900	TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
Q9Y4C2	3.83e-08	532	817	633	896	TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
A5PJN5	1.14e-07	505	817	612	896	TRPM8 channel-associated factor 1 OS=Bos taurus OX=9913 GN=TCAF1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000010	0.006246	0.993791	0.000002	0.000003	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000788_01427.