CAZyme Information: MGYG000000788_01721

Basic Information

• Species: Bacteroides pyogenes
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides pyogenes
• CAZyme ID: MGYG000000788_01721
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000000788_39|CGC1	93539.32	7.0262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000788	2895183	MAG	China	Asia

• Gene Location: Start: 6393; End: 8888 Strand: -

Full Sequence      

MMKRIFSLLPALIMLCPLRAGEHTRNYSIWFDKPNTLEGRAVWYGGRPDMWKGENKPESA
GDTARNPDAAWESRSLPIGNGSLGANILGSVEAERITFNEKTLWRGGPNTSKGAAYYWNV
NKQSAHVLDEIRRAFVDGDGEKAARLTRENFNSEVPYEASRENPFRFGNFTTMGEFYIET
GLSAVGMSGYRRSLSLDSAVAVVQFKKDDVAYKRDFFISYPANVMAVRFAADRPGKQNLT
FSYAPNPVSEGEMRPDGNSGLVYSAALDNNGMKYVVRIRAVAKGGTLSNAGGKIRVEGAD
EAVFYITADTDYKMNFDPDFNDPKTYVGVNPDETTRQWADDAEAKGYEALLAEHYADYSS
LFRRVKLNLNPGMQVADVPTDERLRNYRKGQPDYYLEELYYQFGRYLLIASSRPGNMPAN
LQGIWHNNVDGPWRVDYHNNINVQMNYWPACSANLDECMLPLIDFIRTLVKPGEKTARAY
FGARGWTASISGNIFGFTAPLESQDMSWNFNPMAGPWLATHVWEYYDYTRDKKFLKEIGY
ELIKSSARFAVDYLWHKPDGTYTAAPSTSPEHGPVDQGATFVHAVVREILLDAIEAGKVL
NVDRKERKEWEEVLARLAPYRIGRYGQLMEWSADIDDPNDHHRHVNHLFGLHPGRTISPV
TTPEWAKASKVVLRHRGDGATGWSMGWKLNQWARLHDGNHAYTLFGNLLKNGTLDNLWDT
HPPFQIDGNFGGTAGITEMLLQSHMGFIQLLPALPDAWKEGSVNGIRAKGNFEVSMKWRN
GKLTEAVVLSNAGEQCILKYAGQTLSFKTVKGASYRILCDDSGKWFKELIN

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	63	804	1.3e-275	0.9792243767313019

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.61e-56	66	314	5	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
COG1554	ATH1	2.20e-05	522	617	443	548	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.23e-05	508	617	97	229	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM67747.1	0.0	2	820	1	822
QRP59523.1	0.0	2	820	1	822
QQT78592.1	0.0	2	820	1	822
QUU06495.1	0.0	2	820	1	822
QTO26524.1	0.0	2	817	1	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	6.71e-163	67	793	29	736	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	1.41e-159	67	796	10	750	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	1.38e-154	65	804	46	763	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	6.69e-148	49	812	17	864	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	5.14e-147	49	812	17	864	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	2.90e-144	8	812	16	826	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	5.95e-105	75	786	38	764	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	3.52e-75	78	778	46	775	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.25e-57	69	785	24	701	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000360	0.998833	0.000303	0.000171	0.000163	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000788_01721.