CAZyme Information: MGYG000000790_01380

Basic Information

• Species: Fusobacterium nucleatum_E
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium nucleatum_E
• CAZyme ID: MGYG000000790_01380
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		44195.03	10.0063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000790	2081813	MAG	China	Asia

• Gene Location: Start: 1688; End: 2812 Strand: -

Full Sequence      

MIKKLNRIFQDYMREKRLKIGKYIWDRKEKVKIINGDNFIKDNDIKSILFLRYDGKIGDM
IVNSLMFREIKKVYPDVKIGVVARGAAIDIIKDNPNVDRIYEYYKNRKKIKDLALKIKEE
KYDLLIDFSEMIRVNQMMLINLVGARINLGLDRKNWKLFDLSIESNKDFKWTEHITKRYL
AYLVKLGLKKDSVNLSYDIYLKDEKKYEVFFNKIKENKKIVLNPYGASKHKSFSIENLDK
IIDFLKDKNVAVILVYFEDKYKELAYLEKKYKNVYIPKKIESILDTAILIKKSDYVISPD
TSIVHIASALDKKLIAIYPPKGGKYGVDHLVWAPKSDYAKVIFCKDKESSHDEIDINTFN
FDEMKNEIIKMLKK

Enzyme Prediction     

No EC number prediction in MGYG000000790_01380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	112	322	4.9e-26	0.8177777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.02e-59	45	374	1	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	9.06e-41	47	342	1	240	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	3.53e-13	48	346	10	310	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	7.11e-12	113	342	4	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	3.42e-04	281	342	249	305	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR56601.1	2.94e-233	1	374	4	377
QQB72907.1	1.29e-232	1	372	4	375
EEU32628.1	2.41e-232	1	374	4	377
ATV05921.1	4.69e-232	1	373	4	376
QQS88563.1	7.44e-232	1	372	4	375

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	2.43e-13	45	334	40	321	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2
Q9R9D5	4.78e-08	58	337	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
Q57336	1.17e-06	46	318	9	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000790_01380.