CAZyme Information: MGYG000000791_01245

Basic Information

• Species: CAG-269 sp900551615
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900551615
• CAZyme ID: MGYG000000791_01245
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000000791_32|CGC1	36555.65	8.3383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000791	1608604	MAG	China	Asia

• Gene Location: Start: 8104; End: 9078 Strand: -

Full Sequence      

MKKFLVINTSFFGDTLLTNPLCRNIKILYPDSHITFIVNKPFVEVATYCDGVDEVVAYDK
KGKHHGVKGAWNFYQEYKEKFKLGFEAAFVIYGNERGIVLAKLFGAKKVYAENKGIINFL
LDNPREIDYHGKTKVQTKNSILLEQYSKKAIRELPMKFIPAESSYDDIEVLLEGLNIQDN
KLVAICTTSKKKEKDMPLKDCKELIQTLKSKGYTLLLLGAGNVAKEYGEELSKIAKDDFI
NLVDKTTIAQLGALLANCKALISVDTGTMHLGLAVDVPTVCLFYIHTKAHLDAWAPEKSL
YRCEVLTENIKVENIVNSLRKIME

Enzyme Prediction     

No EC number prediction in MGYG000000791_01245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	297	2e-30	0.8355555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	6.06e-39	3	303	1	239	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	9.07e-39	1	283	1	277	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.41e-16	179	296	104	222	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.19e-10	203	283	204	287	ADP-heptose--LPS heptosyltransferase RfaF.
PRK10422	PRK10422	3.46e-07	2	283	6	288	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB60895.1	3.17e-234	1	324	1	324
SNU93708.1	2.37e-160	1	324	1	321
ALA96520.1	3.43e-25	3	319	2	302
BBM37281.1	8.59e-24	3	276	2	262
AEI15831.1	1.33e-23	1	283	1	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.51e-10	2	283	9	287	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	6.54e-06	3	283	2	287	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000791_01245.