CAZyme Information: MGYG000000793_00830

Basic Information

• Species: Succinivibrio sp900548485
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900548485
• CAZyme ID: MGYG000000793_00830
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		41670.59	7.8438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000793	1894833	MAG	China	Asia

• Gene Location: Start: 34; End: 1161 Strand: +

Full Sequence      

MTFPNIHLEVLVHLPKILSIRTKITRKIISMRPCVLIGIDAPDFNLSVEKRVRAAGIPTV
HYVSPSVWAWREGRMKKIRKACDCVLALLPFEKNFYDNQNVKCVYVGHTLAQSIPMENSQ
ESARERLDLFRTSVEPIHGKVMGILPGSRYGVISNMLPIYAATARMVKAKLKDTVFISSV
PSYAHAQLLKDAWLEHAPDLSLTIYVGNTIDMMASCDAILLTSGTVALEVTLAKVPFCVA
YKVNPLTAALARKLLKVDTFSLPNLIAGHKVVSEFIQENCTAEALTEEMIKLLTSDNLLM
KKEFYKIHEAIRCNSDEIATQAILDIVKQCGNNLSDKEDAESSPAVSERNNIEPEVTLPD
TSALKTSTDKTEPKF

Enzyme Prediction     

No EC number prediction in MGYG000000793_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	312	1.9e-97	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.62e-133	9	329	62	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.83e-113	9	329	62	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.39e-93	9	323	59	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.92e-85	9	326	66	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.42e-36	39	312	83	329	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCV67379.1	1.02e-89	9	324	67	376
QIJ05384.1	2.05e-89	9	324	67	376
QWL03673.1	2.05e-89	9	324	67	376
BCV37365.1	2.89e-89	9	324	67	376
QWK94058.1	3.27e-89	9	329	74	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.10e-74	20	328	78	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.15e-73	20	328	78	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KNT0	1.75e-85	9	327	67	379	Lipid-A-disaccharide synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=lpxB PE=3 SV=1
Q085C9	2.33e-85	9	328	67	380	Lipid-A-disaccharide synthase OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=lpxB PE=3 SV=1
A0KZ10	2.55e-85	9	327	67	379	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=lpxB PE=3 SV=1
A8FY29	6.19e-85	9	328	67	380	Lipid-A-disaccharide synthase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=lpxB PE=3 SV=1
Q8EGG2	2.86e-84	9	327	67	379	Lipid-A-disaccharide synthase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000793_00830.