CAZyme Information: MGYG000000794_01377

Basic Information

• Species: Megamonas sp900554895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900554895
• CAZyme ID: MGYG000000794_01377
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38674.96	9.7106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000794	2368186	MAG	China	Asia

• Gene Location: Start: 9353; End: 10387 Strand: +

Full Sequence      

MNILIVKLSAIGDVIHALPVSYALRQKFPDAHITWVVEPTAYEIVKHNPCIDEIILFEKK
SFKTLKGFRKNFKPLYKLLHQRKYDISIDLQGLFKSLAVVLTANARRKIGYVDMREGSNL
VSKAVRGSHYNGHIVDRYLDTVKILGCDTDNINFPLENTADEISYVNNLLKNNGINETDK
FITFAVGTNWSNKCWSTKNFAQLSDLLAKYNLKTILIGFGKNDEQKAAKIIQQSNLNNIV
NLTSKTTLMQTAALIKKSCAVVGGDTGNLHLAAALKVPAIMLMGPTDPNRNGPYRQIHNV
ILAGHDCDGCWKRTCRKNIDCLSTIKPEQVLEKILKIEMFNNEK

Enzyme Prediction     

No EC number prediction in MGYG000000794_01377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	318	6.2e-53	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.67e-79	2	334	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.88e-72	1	337	2	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02193	heptsyl_trn_I	1.06e-48	2	294	1	291	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	4.67e-36	75	316	4	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.53e-26	3	287	8	292	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU93739.1	1.61e-214	1	343	1	343
BDA10852.1	7.31e-183	1	343	1	342
QIB60900.1	5.99e-182	1	343	1	342
CBL05403.1	6.96e-181	1	343	1	342
AOH47156.1	4.17e-117	2	334	3	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.28e-27	2	332	10	339	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	1.01e-20	1	303	1	299	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.01e-20	1	303	1	299	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.12e-20	1	303	1	299	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	2.28e-10	2	334	2	339	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.49e-24	2	301	10	299	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P24173	5.04e-20	1	334	1	316	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P25742	5.41e-18	12	335	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P26469	7.44e-18	1	294	1	290	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q9R9D5	1.78e-15	12	287	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000794_01377.