CAZyme Information: MGYG000000794_01852

Basic Information

• Species: Megamonas sp900554895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900554895
• CAZyme ID: MGYG000000794_01852
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000000794_141|CGC1	76340.91	6.3866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000794	2368186	MAG	China	Asia

• Gene Location: Start: 2485; End: 4524 Strand: +

Full Sequence      

MGEITGEECNAVGINTVMSPVVDISRDLRWGRCYETFGEDVYLTTQMGINYVKGMQSKNV
SCIAKHFLGYAETQGGLNTAVTRLNKKELYEIFATPFEAMDKTVALDGIMASYSEIDGLP
VGCNKEIIDDLLRKTMGFKGLLTSDGAAIWKIYDYFKLTRSYKEAGLLAKKAGLDTEIPI
GGAYRYLVDFVKNKQLDENIIDISVKRVLNIKFKLGLFEKPYIEEKNVFNRLTDVSKRIF
SREIADNSIVLLSNKGNILPLNTTYKIALIGPHADSKRYPISGYSYPAYIEMLQSLKNDR
KKDISFNGIIDEENKSYDNQGFNTMYNIFQDDDWNYLNDMNKILDDIQADTLKEELETFY
QVSYCKGCDISDIKINDIENACQIAKKSDVIILTVGGNCGWVNVTIGEGKDRCTLNLPGL
QEELLVKLQMTNKPIILIMYGTIYNIPSIKNIKAILYAGLPGPYSGKSLTGILNGSINPS
GKLPITVPRSVGQIPIYYNHKVGSGYHSIGDKAMTTIFSGGYIDDEYSPLYPFGFGLSYT
TFYIDDIKVRNKTINLGSDIILSCRIKNIGSVTGSEVIQIYYYFKDAHVIRPNRQLIAFK
KIMLKPDEIKTVIFTINTRQLGYYNEEMQFVIEPGQADLMIGTSSENIIYTTEINLIGKT
LNILGKREYISKAEILKSI

Enzyme Prediction     

No EC number prediction in MGYG000000794_01852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	178	1.8e-49	0.7731481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.36e-124	1	645	138	754	beta-glucosidase BglX.
COG1472	BglX	6.16e-60	1	307	101	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.58e-50	16	642	152	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	8.63e-48	1	211	106	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	9.11e-42	249	539	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU95883.1	0.0	1	676	134	809
QAT49116.1	2.07e-262	1	675	132	816
QQA37498.1	3.99e-226	1	678	132	807
ADD01525.1	3.21e-153	1	659	135	769
ADH60039.1	3.56e-152	1	659	135	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.72e-91	1	648	134	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.48e-90	1	648	134	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.91e-86	3	657	163	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.80e-85	4	648	121	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.41e-85	4	648	121	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.31e-95	1	646	108	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	9.51e-95	3	645	161	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	6.61e-92	1	648	138	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	4.88e-91	1	648	138	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P14002	2.63e-66	1	656	88	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000794_01852.