CAZyme Information: MGYG000000795_00517

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000795_00517
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	MGYG000000795_16|CGC1	30197.55	8.9219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000795	1972498	MAG	China	Asia

• Gene Location: Start: 23513; End: 24343 Strand: -

Full Sequence      

MTGYYEPLLTVSKHRTERHTTPILSTPDDLIIVDLAEAYPKLKGMRLRGKIQGRKLVPYD
TRAKIVARKDLDKYSIAWSDDPVAVFFLQIQGSGRLRTEEGELIRVGYDDQNGWERYRAT
LPLSRKDIICARYLSIIVFSAVMACAAALLSIVSIPLFNSVGIPSTGQTVFETAIASTAS
MLISLMMVFLAQPLFFRFGHMEALRLSVGLFALLGCLAMATLSSSNPISNWLMSIAGANP
DPAVLGCLCAGIAVLALVLFALSCAISTKVYRARDL

Enzyme Prediction     

No EC number prediction in MGYG000000795_00517.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	10	117	3.1e-32	0.6878980891719745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	1.17e-47	1	119	68	185	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	5.03e-45	9	119	1	111	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	1.87e-36	8	119	1	107	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
COG2821	MltA	2.09e-24	1	119	103	221	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam13346	ABC2_membrane_5	1.73e-16	108	271	58	205	ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU66434.1	8.19e-56	1	113	130	242
QQQ97583.1	8.19e-56	1	113	130	242
QDA55021.1	1.24e-41	1	119	126	243
BBF22454.1	5.71e-41	1	119	125	242
BCT69048.1	7.26e-35	1	113	123	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	2.49e-28	1	119	102	218	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	5.60e-15	1	112	118	264	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	1.38e-14	1	112	118	264	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
3CZB_A	3.96e-13	1	113	81	190	Crystalstructure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15],3CZB_B Crystal structure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15]
6QK4_B	2.44e-08	1	119	103	197	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
133	155
174	196
203	222
242	264