CAZyme Information: MGYG000000806_00611

Basic Information

• Species: Blautia_A sp900541345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900541345
• CAZyme ID: MGYG000000806_00611
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000000806_11|CGC1	65603.75	6.673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000806	2686211	MAG	China	Asia

• Gene Location: Start: 1443; End: 3131 Strand: -

Full Sequence      

MDIIYVSYNSEKWIERCFGSVLKSEYDLKKVNIYVVDNHSSDHTLEKLKKIKPEMEEQVG
SFQVMESQENLGFGRGNNLGFSKGNSELVCFFNIDTELLPDTLKELEEAVDASDEKTAMW
ELRQFPYEHPKNYNPLTGETTWSSGAAFAMKREIYEKLGGFDEKIFMYAEDVDLSWRLRS
FGYKIRYVPKSVIMHYSYEEAGEIKPNQHVYGVINNMMLRYRFGGLKDILKGHLKFWFLM
VTPEAFPGSKKMLRREYWRHFGKIPHFYSRKTRGKDVAFQPEFLNWDYSINREGGFYFNE
FPKETPKVSIIVRTCGRPSVLRETLVSLRNQTYPNIEVVVVEDGENVSEKMLREEFGDLN
IVYRATGKKAGRSKAGNLAMSAATGKYLNFLDDDDLFYADHVEVLVTNLLKTENRAAYSF
AFETPVEVRSKEPYIYEVKGLNATHTQEFDKVKLCHHNYIPIQAIMFEKSLFEEFGGLDE
TLDALEDWDLWVRYSLHTDFTCVKKTTSLYRVPHDRKMNSERQKALDEALAVVRNKHKTY
IQTVSVYDIAMMYEKRSILPPR

Enzyme Prediction     

No EC number prediction in MGYG000000806_00611.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	309	434	8.8e-22	0.7529411764705882
GT2	2	168	5e-20	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.75e-49	3	196	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.80e-37	3	265	7	287	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	7.33e-22	3	188	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	3.08e-19	3	196	2	193	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.52e-19	309	418	1	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV25728.1	1.53e-201	1	549	8	555
QGG58197.1	8.11e-188	1	554	4	556
QTA80415.1	4.35e-147	1	554	12	565
QJR09954.1	2.52e-145	1	552	4	563
APV52136.1	4.52e-143	1	552	4	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	5.53e-10	308	549	7	252	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZDI9	1.16e-15	305	494	7	193	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
Q68X33	2.82e-15	305	494	7	193	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q4UM29	3.13e-11	306	493	14	200	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q48214	6.60e-11	308	553	2	242	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
Q1RIM7	7.96e-11	307	515	292	492	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000806_00611.