CAZyme Information: MGYG000000806_01259

Basic Information

• Species: Blautia_A sp900541345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900541345
• CAZyme ID: MGYG000000806_01259
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		86971.14	4.2845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000806	2686211	MAG	China	Asia

• Gene Location: Start: 322; End: 2628 Strand: +

Full Sequence      

MRKKIHKRISLVMAACMTAGMMGSVNVQAESLYKQEDFANVLDATARLDETLYSHYATDK
YNVFSDMGAWHGYYLHGLDDLDTFGGFAGPQIIGQDTGMNLSDCISRLKLTKANGEEINL
ADARWPYVAYYPGKLMQYYEERDEYKVTLELIFASNRTNYVRTTIENYSDEPLVLDVAWE
GKLFSENKAWGESYPTNATFEDSENGVQVGFKEYSDAWTTTEDTKYTIRHNEEVSTELSE
DKMSYVSKTTKPITIEKGTPYVTYTAESYTFTADEAANEAEVVKTLFADPEKPFEDNRTR
WQGYLDKTFEQEDGVAKPYKNAAVKAMETLVTNWRSPAGKFKHSGLIPSMSYSGFIGVWG
WDTWKNAAGIAGFDPQLAADGIRCMFDYQIQDNDPERPQDAGTIIDCFSYGENSGNYRNS
KPPLAAWGVWKTYQEGGDKAFLEEMYPKLTAYHDWWYTNRDTDHNGVAEYGGMVHKAHYQ
KDEDGNILKDENDKPLLNVENIIEAAAWESGMDNATRFDQEGNGPDDIGVLVYENKNAEG
EVVGYSLNQESVDLNAMLYAEKGFLKSIAEELGKTEDAAKYEAEAEKLAEYINTNMWDEE
TGFYYDLQINEDGSEKKILTNRGKGTEGWMPLWAKLAPADRAEKVKDNMMDEGKFNLRVP
MPTASFDNDKFNPSRYWRGPVWLDQALYGVESLQNYGYEEEATELAYKLFDGAEGVLTDG
PIHENYNPVTGEGLHTKNFSWSAAAYYMLYEDALAETNPSTQTGLEMK

Enzyme Prediction     

No EC number prediction in MGYG000000806_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	11	754	8.7e-173	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	8	752	2	782	alpha-glucosidase; Provisional
pfam01204	Trehalase	6.92e-21	420	749	178	504	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.55e-14	344	750	268	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	4.30e-13	552	709	354	499	Neutral trehalase [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	6.11e-13	552	743	252	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM60257.1	5.62e-297	2	765	4	777
BAK81591.1	1.50e-296	33	768	31	769
AIY84390.1	1.16e-294	2	765	4	777
QQP70135.1	3.48e-292	34	762	57	793
QTI52827.1	1.61e-288	2	768	7	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.08e-136	36	752	3	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.15e-135	36	752	3	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.61e-135	36	752	3	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	3.50e-130	36	752	4	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.73e-59	485	752	9	304	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.14e-135	36	752	26	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.84e-13	420	744	166	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	8.49e-13	359	744	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
Q757L1	2.92e-09	551	748	479	701	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
P49381	3.48e-08	551	748	495	717	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001298	0.994805	0.002866	0.000441	0.000289	0.000260

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000806_01259.