CAZyme Information: MGYG000000806_01769

Basic Information

• Species: Blautia_A sp900541345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900541345
• CAZyme ID: MGYG000000806_01769
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000000806_56|CGC1	55111.99	5.4408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000806	2686211	MAG	China	Asia

• Gene Location: Start: 5303; End: 6712 Strand: +

Full Sequence      

MNALTRDLRKLVEKTEKEAVHYDRFRQKIHLMPPVGWLNDPNGLCEFKGEFHSFFQYSPF
DEEGGLKFWGHCISKDMIHWTYKGVALYPDQPFDCHGVYSGSAFIEDGKMYLYYTGNVKL
EDGEFDYIRTGREANTVLVISEDGRSFSQKKELMRNRDYPKDVTCHVRDPKVWKEKDRYY
MVQGARTEKDEGQVLLFESKDKYSWNLKNRISTKEKFGYMWECPDYFEVDGVKLLSASVQ
GLEGEEWKERNVYQSGYFFLNGDIKGDGQLSSYCLWDYGFDYYAPQTFETEDGRRIQISW
MGMPDCPEYTNHTVKDGWQHCFTFPREISVKNGHVLQNPVRELEAVRKNREEAEEIFRKS
NRTKTYEIFVEKIKDNHFYAVLGEELILKYGDGEFEMCFQDQKNDSVSAGRKSRRCTVKE
LLNVRILADVSSVEVFLNDGAQVFSTRYYPEKYSALVEGPDAKITFWEL

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	339	8.2e-90	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.71e-156	36	332	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.06e-140	13	450	1	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.37e-126	8	457	9	466	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.75e-108	30	440	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.10e-107	30	339	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB24857.1	4.71e-249	1	469	1	468
QEI32364.1	4.71e-249	1	469	1	468
QRT30958.1	2.22e-247	1	469	1	468
CCG93499.1	9.96e-244	1	469	1	468
QRT48577.1	1.43e-235	1	466	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	5.43e-68	24	450	24	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	4.01e-60	16	451	39	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.83e-59	16	451	39	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	4.71e-56	25	449	32	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	5.05e-56	25	469	2	427	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.27e-103	12	450	16	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	4.84e-81	23	449	34	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P16553	4.27e-80	29	451	27	450	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
Q05936	2.92e-78	18	452	26	466	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P40714	4.02e-77	25	451	24	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000806_01769.