CAZyme Information: MGYG000000809_01617

Basic Information

• Species: UBA1691 sp900549825
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900549825
• CAZyme ID: MGYG000000809_01617
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	MGYG000000809_14|CGC1	66195.03	5.6986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000809	2343519	MAG	China	Asia

• Gene Location: Start: 30961; End: 32700 Strand: +

Full Sequence      

MTNLPRPEYPRPQFFRDAWQTLNGEWAFQIDHGRSGRDRGQSSPDARFDKTILIPFCPES
KLSGIENKDFMESVWYRRTLTLTQAQLAGRVLLHFGAVDYACTVFLNGAECGTHRGGYSS
FQFDITQYVHPGENTLTVHAVDHQRDGTQPHGKQCDKYHSAGCHYTRTTGIWQTVWLEFV
PPVYLESVHLITDFRTGSITFRAVVNQLPKELFLRTSITFAGKPCASATVPLSAGGTVYS
MQVENVKCWDVLQPNLYDLTYELLDGETVIDAVQSYFGFRTVELRDHAIWLNGRPVFQRL
VLDQGYYPDGIYTAPTDADLKRDIERSIALGFNGARLHQKVFEERFLYWADQLGYLVWGE
QASWGLDLTTSEGLVHFLPEWLEVVERDCNHPSIVGWCPFNETWDQVHRRADKRVLEAVY
LATKAADPTRPVIDTSGNYHARTDIYDVHDYEQDVNIFAARYGAVTRETVYEPYPDRQHY
EGQPYFVSEYGGAWWAPGRKKGWGYGKAPESEAEFARRYASLTRALMENPNICALCYTQL
YDVEQEQNGLYTYERAPKFSPGIYEQIRAANSAPAGNEK

Enzyme Prediction     

No EC number prediction in MGYG000000809_01617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	16	500	4.2e-102	0.5398936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.96e-45	20	448	13	444	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	9.71e-39	22	432	15	445	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.16e-26	7	446	56	486	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.88e-23	76	432	124	485	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	1.29e-14	20	138	2	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95984.1	1.39e-311	3	579	2	578
ALS26546.1	6.58e-238	4	579	9	587
ANY74929.1	8.71e-237	2	578	5	581
ANU54514.1	1.34e-233	3	579	2	582
QQR31538.1	1.34e-233	3	579	2	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	5.48e-83	7	555	27	565	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4JKM_A	3.20e-33	22	432	18	444	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
7VQM_A	6.90e-31	73	492	95	500	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
3K4A_A	1.31e-29	22	491	17	508	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	2.33e-29	22	491	17	508	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.02e-28	9	404	43	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	4.13e-28	22	491	15	506	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	2.08e-26	66	405	50	391	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
O97524	9.31e-26	9	441	29	488	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
P26257	6.12e-25	22	565	7	542	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000809_01617.