CAZyme Information: MGYG000000810_01100

Basic Information

• Species: Sutterella sp900543805
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900543805
• CAZyme ID: MGYG000000810_01100
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000810_10|CGC2	38120.12	8.2432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000810	2278510	MAG	China	Asia

• Gene Location: Start: 30400; End: 31485 Strand: -

Full Sequence      

MSTERHLVIAAAGTGGHVMPGLAVAAVMRSRGWRVSWIGTTTGMEASLVEKHGIDFYALN
FQGVRGRGLVGAVKGGVKLLSSGIEARRVLGELKPDAVFSTGGYVAVPVGYAAKTLGIPL
VLMNCDADLLLSTQTLMPVCRFLACGFAGGARSWAKEKGRTTGNPVRADILAIDPPDERL
AGREGRLRLFVFGGSLGAKILNDTVPEALAKIPEDVRPEVVHQTGRDRDEAVRARYEALG
VKATVLPFIDDMATRYRESDLVLCRAGATSVSELCAAGAASVLVPFVAKTTAHQLGNARF
MAERGAARMLKNEECTPEALAALLEGLTRDDILAMAKNARSLARPMAAEGVADLIEEALA
A

Enzyme Prediction     

No EC number prediction in MGYG000000810_01100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	346	3.5e-47	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	5.40e-143	5	361	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.67e-121	6	354	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	8.43e-114	7	357	3	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	3.50e-107	5	355	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	3.99e-40	189	357	2	165	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22505.1	1.24e-176	4	358	6	360
QDA55069.1	2.57e-169	4	361	10	367
QQS89342.1	4.95e-161	5	360	14	369
QQQ95911.1	6.57e-125	4	356	2	354
ANU67058.1	6.57e-125	4	356	2	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	4.08e-75	4	353	2	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	7.89e-75	5	353	7	348	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	5.08e-73	2	357	7	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1GZ01	9.57e-113	4	356	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=murG PE=3 SV=1
Q7NPZ9	7.20e-108	4	357	3	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=murG PE=3 SV=1
A2SCY5	2.93e-106	3	356	2	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1) OX=420662 GN=murG PE=3 SV=1
A6T2F8	1.50e-101	5	357	2	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=murG PE=3 SV=1
A4G8T8	5.51e-99	5	357	2	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Herminiimonas arsenicoxydans OX=204773 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29