CAZyme Information: MGYG000000813_00680

Basic Information

• Species: Zag1 sp000437435
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000437435
• CAZyme ID: MGYG000000813_00680
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		65089.24	9.4683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000813	1978596	MAG	China	Asia

• Gene Location: Start: 620172; End: 621848 Strand: +

Full Sequence      

MEKTINFIKKHSDLFIFLGLLLICYFVFFFNIGNYALMDVDETRYVSMARDMFHSKDFLT
LYLNGEYFFEKPPLYFWGECLSFAIFGKINEFTARFPVALYGTLSTLIVYFTGKKIVSRR
FGFISAVILATTLEFVMLAKFAILDIVVTTCVGFSVMFGFLTQFVHDKNKKYFWWMFYIF
SGLAVMAKGIPGFVVPFAVMFFVTIANKTFKQVFRPQYILPGFLLFFLIVVPWHLIMFKI
HDPLFFREYIIKHHLERFLNSNEINREQPFYFYFITVLWGLIPWVFSAIAVGITKLKSFK
KFAVENLSDRHKFLLFNVIAFAVTMLFFSSSSTKLITYILPVYFFTAFIMGALWESYIFD
EKYKKPVNLSVYILGGICIFAGVVTCFAKYVLPAQVYSDLLIIKWFCISLVIIFGISSIL
CAVKNFRKGVFACYALLIIITSAFGTKLFYNMDYEFGQNDLMQFAKYAKENNKKIVVLNN
ERKYSVLYYYGSPVDKNTKSRVYFISQDDEAEMAKLGHILDDRDVVVVVREKQMPQVDKT
LDFDIILDGRKYSLVKVH

Enzyme Prediction     

No EC number prediction in MGYG000000813_00680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	17	491	1.2e-100	0.8611111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.03e-48	26	489	19	464	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.48e-26	41	352	32	331	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	7.45e-17	71	233	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	9.11e-13	26	241	9	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	1.44e-07	25	241	35	267	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	0.0	1	558	1	557
ACM19911.1	2.17e-50	18	382	19	371
ABQ27847.1	2.77e-48	18	384	19	375
AJE04087.1	7.04e-47	37	356	39	347
QEM66831.1	1.08e-44	28	383	30	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.61e-20	27	342	44	352	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.79e-27	27	381	15	344	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B4ETL9	9.89e-20	19	432	11	414	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
Q7N3Q9	1.66e-17	37	439	31	421	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B4EUL1	5.09e-17	9	384	7	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
A0KGY4	8.95e-17	25	352	11	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999526	0.000019	0.000007	0.000000	0.000000	0.000483

TMHMM  Annotations     

start	end
15	37
92	111
116	138
143	165
175	197
218	237
270	292
313	330
335	357
369	391
401	423
430	452