CAZyme Information: MGYG000000813_01128

Basic Information

• Species: Zag1 sp000437435
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000437435
• CAZyme ID: MGYG000000813_01128
• CAZy Family: GT2
• CAZyme Description: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		58560.18	8.978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000813	1978596	MAG	China	Asia

• Gene Location: Start: 340907; End: 342436 Strand: +

Full Sequence      

MSQPLLSICIPTYNRACYLWRTLNSITTQKGFLFTDLVEIVISDNCSTDGTEEVCMEFVK
KYPDKIRYIKRDVPISGDENFVFVINQASGKFVKLHNDTCYVLEDSMSNIINDVQNADEL
GADACFFANSSMSKEGLIKSFNDLISNVSYFITWIASHCYRKSFLDSLDNINRYSNLNFA
QVDLLGRLFENGSSLYLSNKNYFSTIYVKGKGGYNIAKVFGYNYFYILELYKNKGLISKK
VFNQNKFKTLFEHIIPYYFDFKKEYNFSKGNYFKNMKYYWFEPYFYFSFIKVLRDFLGCF
KYKNLKRLRRNRKPEYVWKRQNFDNHTSLIINGSLFDNIAIGKGSYGDVNAIFSNKSAVS
LIIGNYVSIAPDVLFIPESEHNYKNLSTYPFKVMMLGENYEALSKGSIIVEDDVWIGART
VILSGVRIGQGAIIAAGSVVTKDVEPYSIVAGNPAKLIKYRFEDNIRAELRAFNIGMLTK
NIVKDNIDKVYESLTEDNVKNVLNIIKGV

Enzyme Prediction     

No EC number prediction in MGYG000000813_01128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	129	3.4e-16	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03349	LbH_XAT	8.21e-54	338	472	1	138	Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.
cd04647	LbH_MAT_like	7.21e-34	338	458	1	109	Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.
cd03357	LbH_MAT_GAT	8.28e-28	338	458	62	169	Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
COG0110	WbbJ	8.95e-26	325	472	18	189	Acetyltransferase (isoleucine patch superfamily) [General function prediction only].
cd03358	LbH_WxcM_N_like	4.54e-24	337	459	3	119	WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF84575.1	5.86e-49	4	503	31	573
SDT46839.1	7.91e-43	6	257	4	255
AMR32929.1	6.43e-38	1	258	4	263
QKJ31486.1	1.52e-37	6	260	4	258
AEE16252.1	3.66e-28	2	264	3	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MFK_A	4.65e-21	361	492	65	211	ChainA, Chloramphenicol acetyltransferase [Elizabethkingia anophelis]
1KHR_A	4.12e-19	337	493	28	199	CrystalStructure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KHR_B Crystal Structure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KHR_C Crystal Structure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KHR_D Crystal Structure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KHR_E Crystal Structure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KHR_F Crystal Structure of Vat(D) in Complex with Virginiamycin and Coenzyme A [Enterococcus faecium],1KK4_A Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK4_B Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK4_C Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK4_D Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK4_E Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK4_F Crystal Structure of Vat(D) in Complex with Acetyl-CoA [Enterococcus faecium],1KK5_A Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK5_B Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK5_C Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK5_D Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK5_E Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK5_F Crystal Structure of Vat(D) (Form II) [Enterococcus faecium],1KK6_A Crystal Structure of Vat(D) (Form I) [Enterococcus faecium],1KK6_B Crystal Structure of Vat(D) (Form I) [Enterococcus faecium],1KK6_C Crystal Structure of Vat(D) (Form I) [Enterococcus faecium],1MR7_A Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MR7_B Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MR7_C Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MR7_X Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MR7_Y Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MR7_Z Crystal Structure of Streptogramin A Acetyltransferase [Enterococcus faecium],1MRL_A Crystal structure of streptogramin A acetyltransferase with dalfopristin [Enterococcus faecium],1MRL_B Crystal structure of streptogramin A acetyltransferase with dalfopristin [Enterococcus faecium],1MRL_C Crystal structure of streptogramin A acetyltransferase with dalfopristin [Enterococcus faecium],3DHO_A Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium],3DHO_B Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium],3DHO_C Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium],3DHO_D Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium],3DHO_E Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium],3DHO_F Structure of Streptogramin Acetyltransferase in Complex with an Inhibitor [Enterococcus faecium]
3EEV_A	5.16e-18	338	464	24	168	CrystalStructure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3EEV_B Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3EEV_C Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],6PUA_A The 2.0 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6PUA_B The 2.0 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6PUA_C The 2.0 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6PUB_A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae in the Complex with Crystal Violet [Vibrio cholerae O1 biovar El Tor str. N16961],6U9C_A The 2.2 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae in the complex with Acetyl CoA [Vibrio cholerae O1 biovar El Tor str. N16961],6U9C_B The 2.2 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae in the complex with Acetyl CoA [Vibrio cholerae O1 biovar El Tor str. N16961],6U9C_C The 2.2 A Crystal Structure of the Type B Chloramphenicol Acetyltransferase from Vibrio cholerae in the complex with Acetyl CoA [Vibrio cholerae O1 biovar El Tor str. N16961]
6PU9_A	6.68e-16	361	462	59	166	CrystalStructure of the Type B Chloramphenicol O-Acetyltransferase from Vibrio vulnificus [Vibrio vulnificus CMCP6],6PU9_B Crystal Structure of the Type B Chloramphenicol O-Acetyltransferase from Vibrio vulnificus [Vibrio vulnificus CMCP6],6PU9_C Crystal Structure of the Type B Chloramphenicol O-Acetyltransferase from Vibrio vulnificus [Vibrio vulnificus CMCP6]
6PXA_A	1.12e-15	343	466	62	179	Thecrystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_B The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_C The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_D The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_E The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_F The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_G The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_H The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_I The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_J The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_K The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114],6PXA_L The crystal structure of chloramphenicol acetyltransferase-like protein from Vibrio fischeri ES114 in complex with taurocholic acid [Aliivibrio fischeri ES114]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23364	5.52e-20	338	465	22	167	Chloramphenicol acetyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=cat PE=3 SV=1
P26840	1.81e-19	361	464	24	134	Probable macrolide acetyltransferase (Fragment) OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
P50868	1.25e-18	338	464	22	167	Chloramphenicol acetyltransferase OS=Klebsiella aerogenes OX=548 GN=catB4 PE=3 SV=1
P50870	2.26e-18	337	493	28	199	Streptogramin A acetyltransferase OS=Enterococcus faecium OX=1352 GN=vatD PE=1 SV=1
P26838	9.26e-17	361	464	57	167	Chloramphenicol acetyltransferase OS=Escherichia coli OX=562 GN=catB2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000813_01128.