CAZyme Information: MGYG000000814_00840

Basic Information

• Species: CAG-521 sp900546995
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900546995
• CAZyme ID: MGYG000000814_00840
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		79377.39	9.9331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000814	1710044	MAG	China	Asia

• Gene Location: Start: 14247; End: 16301 Strand: -

Full Sequence      

MRSRTNEHCMHNPLFLVIAFIALWCIGFSTHAQEITTLADDRVGSNEEFLSLKQAYENRR
PVIVSENVWNNHPLEGYVQAWKLLSELKQPQNTNNKLEKLRTFQKAHKGEFVADYFTREW
LASQAQELHQKNQWKTFTKIRNELHLYRNDPEFICWSMYHDLQSATSTKIKKISQAAIPL
FKQPAFENNAVCKRTFNLLIEVNPSLGFTRLVTLMQLNRGHQAKTVLQSLIKHKRLPKAQ
ATMAFSRPNTWYKKYRRQINRQNKYVALIAAYRLSRTDLAKAAYVANALNQRLNRDERGA
IWGHIGYTAALRQNSKALTWYRVADNAVCRGRYAANQEACLEWQIRSALKVENWKLVNRY
ISRLPKSTQQKDTWLYWQGRALAAMGQAEAAQKQWQQITNVRTYYGKLAAQALGHSITYQ
PQAETQVTQEQVAAIKDKSFSRAIAFYDMGLYSWGHREWNWGLKNLPDVERLIVAQWAFD
HDRLDRMINTAVPVASRLPVSHCMLYPRPHEHTIERFTQQFDLNEDWIYGLIRQESRFIV
SVSSSAGANGLMQIMPATAQWIAKQLEQTDFQRNDIYKIDTNIQFGTYYLRSLLDRLDEN
IVLATAGYNAGPQRAKQWRSTLNKPTEAAIFIETIPFTETRGYVQNVLANTVEYASRSEK
PIDNFKDWLGVISPKPLDDSEEPI

Enzyme Prediction     

No EC number prediction in MGYG000000814_00840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	526	656	2e-25	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.66e-67	505	657	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.47e-46	507	650	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	3.25e-45	207	654	195	624	lytic murein transglycosylase; Provisional
COG0741	MltE	6.52e-38	374	667	3	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.43e-34	525	650	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22242.1	1.51e-115	49	683	164	794
QDA54820.1	7.81e-109	49	674	153	781
AJP56054.1	5.22e-105	98	675	112	668
AKM30817.1	8.39e-103	98	675	112	668
AJC20704.1	1.18e-102	98	675	112	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.81e-64	282	672	187	573	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	2.23e-64	282	672	197	583	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.41e-64	282	672	201	587	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.72e-64	282	672	207	593	Lytictransglycosylase in action [Neisseria meningitidis]
5O1J_A	3.78e-64	282	672	191	577	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.99e-38	39	654	27	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.02e-36	39	654	27	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.02e-36	39	654	27	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.56e-21	360	654	286	572	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.34e-12	511	655	61	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001064	0.995716	0.002580	0.000214	0.000188	0.000185

TMHMM  Annotations     

start	end
13	32