CAZyme Information: MGYG000000814_00978

Basic Information

• Species: CAG-521 sp900546995
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900546995
• CAZyme ID: MGYG000000814_00978
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34154.58	7.8118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000814	1710044	MAG	China	Asia

• Gene Location: Start: 2232; End: 3170 Strand: -

Full Sequence      

MKPIVICRLPNHVGDCCMTLPALRLLDASGFTPYLVGKRFAEDLMLGMGWRFDPIEGHVT
EDLSRLHYLSEQQHKPLGLLFPNSFGSALQFKLAGIRSAGFATDGRYLLLDKKIDEPEKN
VHEVVRFFTVALGAIRAWGGEPAWTEPSKELGLQLIARHTAGAKNLKEKFDIPEKFALIA
PIARGVHHGKIKHWVHINSVVNPLREMGIEPIVMPAPDEIEDAKIACPDARHLPPTNLGT
YAALCREATIVIANDSGVSHVAAAVGAKQLTLVGVTDPKRTGPWNPNATVLGSENGWPSQ
EKVINTLQKILS

Enzyme Prediction     

No EC number prediction in MGYG000000814_00978.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	80	293	3e-25	0.8311111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	1.14e-29	77	296	15	232	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	1.51e-16	3	299	1	248	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.85e-15	1	290	1	294	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	2.89e-07	80	290	85	294	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	2.00e-04	192	312	192	321	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89241.1	1.69e-136	5	312	6	314
QDA55160.1	2.70e-134	5	312	4	311
BBF22597.1	1.24e-130	1	311	1	311
ANU65198.1	6.72e-109	8	312	7	310
QQQ96353.1	6.72e-109	8	312	7	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000814_00978.